"SRSF9" Related Products

Expand

Recombinant Human SRSF9 protein, His-tagged

Cat.No.: SRSF9-09H
Product Overview: Recombinant Human SRSF9(1-221aa) fused with His tag at N-terminal was expressed in E. coli.
Description: The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two pseudogenes, one on chromosome 15 and the other on chromosome 21, have been found for this gene.
Source: E. coli
Species: Human
Tag: His
Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol.
AA Sequence: MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGY DYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMV EYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY
Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name: SRSF9 serine/arginine-rich splicing factor 9 [ Homo sapiens ]
Official Symbol: SRSF9
Synonyms: SFRS9; SRp30c
Gene ID: 8683
mRNA Refseq: NM_003769.2
Protein Refseq: NP_003760.1
MIM: 601943
UniProt ID: Q13242
Chromosome Location: 12q24.31
Pathway: Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem;Gene expression, organism-specific biosystem;Herpes simplex infection, organism-specific biosystem;Herpes simplex infection, conserved biosystem;Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem;RNA Polymerase II Transcription, organism-specific biosystem;RNA Polymerase II Transcription Termination, organism-specific biosystem;
Function: RNA binding;nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.