Recombinant Human SSTR5 protein, His-tagged
Cat.No. : | SSTR5-8525H |
Product Overview : | Recombinant Human SSTR5 protein(P35346)(307-364aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 307-364aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 8.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL |
Gene Name | SSTR5 somatostatin receptor 5 [ Homo sapiens ] |
Official Symbol | SSTR5 |
Synonyms | SSTR5; somatostatin receptor 5; somatostatin receptor type 5; somatostatin receptor subtype 5; SS-5-R; |
Gene ID | 6755 |
mRNA Refseq | NM_001053 |
Protein Refseq | NP_001044 |
MIM | 182455 |
UniProt ID | P35346 |
◆ Recombinant Proteins | ||
SSTR5-16046M | Recombinant Mouse SSTR5 Protein | +Inquiry |
RFL17100HF | Recombinant Full Length Human Somatostatin Receptor Type 5(Sstr5) Protein, His-Tagged | +Inquiry |
SSTR5-8754M | Recombinant Mouse SSTR5 Protein, His (Fc)-Avi-tagged | +Inquiry |
SSTR5-8525H | Recombinant Human SSTR5 protein, His-tagged | +Inquiry |
SSTR5-12485Z | Recombinant Zebrafish SSTR5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSTR5-1699HCL | Recombinant Human SSTR5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SSTR5 Products
Required fields are marked with *
My Review for All SSTR5 Products
Required fields are marked with *