Recombinant Human STK38L protein(212-464aa), GST-tagged
| Cat.No. : | STK38L-593H |
| Product Overview : | Recombinant Human STK38L protein(Q9Y2H1)(212-464aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 212-464aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 56.1 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | RDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDLILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL |
| Gene Name | STK38L serine/threonine kinase 38 like [ Homo sapiens ] |
| Official Symbol | STK38L |
| Synonyms | STK38L; serine/threonine kinase 38 like; serine/threonine-protein kinase 38-like; KIAA0965; NDR2; nuclear Dbf2 related 2; NDR2 protein kinase; nuclear Dbf2-related 2; nuclear Dbf2-related kinase 2; |
| Gene ID | 23012 |
| mRNA Refseq | NM_015000 |
| Protein Refseq | NP_055815 |
| UniProt ID | Q9Y2H1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STK38L Products
Required fields are marked with *
My Review for All STK38L Products
Required fields are marked with *



