Recombinant Human SUPT4H1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SUPT4H1-6165H |
Product Overview : | SUPT4H1 MS Standard C13 and N15-labeled recombinant protein (NP_003159) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes the small subunit of DRB (5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole) sensitivity-inducing factor (DSIF) complex, which regulates mRNA processing and transcription elongation by RNA polymerase II. The encoded protein is localized to the nucleus and interacts with the large subunit (SUPT5H) to form the DSIF complex. Related pseudogenes have been identified on chromosomes 2 and 12. Alternatively spliced transcript variants have been found for this gene. |
Molecular Mass : | 13.2 kDa |
AA Sequence : | MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SUPT4H1 SPT4 homolog, DSIF elongation factor subunit [ Homo sapiens (human) ] |
Official Symbol | SUPT4H1 |
Synonyms | SUPT4H1; suppressor of Ty 4 homolog 1 (S. cerevisiae); suppressor of Ty (S.cerevisiae) 4 homolog 1, SUPT4H; transcription elongation factor SPT4; SPT4H; hSPT4; DSIF p14; DSIF small subunit; DRB sensitivity-inducing factor small subunit; DRB sensitivity-inducing factor 14 kDa subunit; SPT4; SUPT4H; |
Gene ID | 6827 |
mRNA Refseq | NM_003168 |
Protein Refseq | NP_003159 |
MIM | 603555 |
UniProt ID | P63272 |
◆ Recombinant Proteins | ||
SUPT4H1-3056H | Recombinant Human SUPT4H1, GST-tagged | +Inquiry |
SUPT4H1-992C | Recombinant Cynomolgus SUPT4H1 Protein, His-tagged | +Inquiry |
SUPT4H1-16247M | Recombinant Mouse SUPT4H1 Protein | +Inquiry |
SUPT4H1-6165H | Recombinant Human SUPT4H1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SUPT4H1-4564R | Recombinant Rhesus monkey SUPT4H1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUPT4H1-1338HCL | Recombinant Human SUPT4H1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUPT4H1 Products
Required fields are marked with *
My Review for All SUPT4H1 Products
Required fields are marked with *