Recombinant Human SUV39H2 protein, GST-tagged
Cat.No. : | SUV39H2-7854H |
Product Overview : | Recombinant Human SUV39H2 protein(290-350 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 290-350 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | RLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | SUV39H2 |
Synonyms | SUV39H2; suppressor of variegation 3-9 homolog 2 (Drosophila); histone-lysine N-methyltransferase SUV39H2; FLJ23414; KMT1B; H3-K9-HMTase 2; su(var)3-9 homolog 2; lysine N-methyltransferase 1B; histone H3-K9 methyltransferase 2; |
Gene ID | 79723 |
mRNA Refseq | NM_001193424 |
Protein Refseq | NP_001180353 |
MIM | 606503 |
UniProt ID | Q9H5I1 |
◆ Recombinant Proteins | ||
SUV39H2-8888M | Recombinant Mouse SUV39H2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SUV39H2-3063H | Recombinant Human SUV39H2, GST-tagged | +Inquiry |
SUV39H2-3021C | Recombinant Chicken SUV39H2 | +Inquiry |
SUV39H2-209H | Recombinant Human SUV39H2 Protein, His-tagged | +Inquiry |
SUV39H1-12HFL | Active Recombinant Full Length Human SUV39H2 histone lysine methyltransferase Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUV39H2-1333HCL | Recombinant Human SUV39H2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SUV39H2 Products
Required fields are marked with *
My Review for All SUV39H2 Products
Required fields are marked with *
0
Inquiry Basket