Recombinant Human SUV39H2 protein, GST-tagged

Cat.No. : SUV39H2-7854H
Product Overview : Recombinant Human SUV39H2 protein(290-350 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 290-350 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : RLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol SUV39H2
Synonyms SUV39H2; suppressor of variegation 3-9 homolog 2 (Drosophila); histone-lysine N-methyltransferase SUV39H2; FLJ23414; KMT1B; H3-K9-HMTase 2; su(var)3-9 homolog 2; lysine N-methyltransferase 1B; histone H3-K9 methyltransferase 2;
Gene ID 79723
mRNA Refseq NM_001193424
Protein Refseq NP_001180353
MIM 606503
UniProt ID Q9H5I1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SUV39H2 Products

Required fields are marked with *

My Review for All SUV39H2 Products

Required fields are marked with *

0
cart-icon