Recombinant Human SUV39H2 protein, GST-tagged
| Cat.No. : | SUV39H2-7854H |
| Product Overview : | Recombinant Human SUV39H2 protein(290-350 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 290-350 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | RLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | SUV39H2 |
| Synonyms | SUV39H2; suppressor of variegation 3-9 homolog 2 (Drosophila); histone-lysine N-methyltransferase SUV39H2; FLJ23414; KMT1B; H3-K9-HMTase 2; su(var)3-9 homolog 2; lysine N-methyltransferase 1B; histone H3-K9 methyltransferase 2; |
| Gene ID | 79723 |
| mRNA Refseq | NM_001193424 |
| Protein Refseq | NP_001180353 |
| MIM | 606503 |
| UniProt ID | Q9H5I1 |
| ◆ Recombinant Proteins | ||
| SUV39H2-7855H | Recombinant Human SUV39H2 protein, His-tagged | +Inquiry |
| SUV39H2-7854H | Recombinant Human SUV39H2 protein, GST-tagged | +Inquiry |
| SUV39H2-29907TH | Recombinant Human SUV39H2 | +Inquiry |
| SUV39H2-209H | Recombinant Human SUV39H2 Protein, His-tagged | +Inquiry |
| SUV39H2-3021C | Recombinant Chicken SUV39H2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SUV39H2-1333HCL | Recombinant Human SUV39H2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUV39H2 Products
Required fields are marked with *
My Review for All SUV39H2 Products
Required fields are marked with *



