Recombinant Human SYNPO2 protein, GST-tagged
Cat.No. : | SYNPO2-018H |
Product Overview : | Recombinant Human SYNPO2 protein(111-350 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 111-350 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | GYVESTTLQIRPATKTQCTEFFLAPVKTEVPLAENQRSGPDCAGSLKEETGPSYQRAPQMPDSQRGRVAEELILREKVEAVQPGPVVELQLSLSQERHKGASGPLVALPGAEKSKSPDPDPNLSHDRIVHINSIPTNEKADPFLRSSKIIQISSGRELRVIQESEAGDAGLPRVEVILDCSDRQKTEGCRLQAGKECVDSPVEGGQSEAPPSLVSFAVSSEGTEQGEDPRSEKDHSRPHK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | SYNPO2 |
Synonyms | SYNPO2; synaptopodin 2; synaptopodin-2; MYOPODIN; myopodin; genethonin 2; genethonin-2; DKFZp686G051; |
Gene ID | 171024 |
mRNA Refseq | NM_001128933 |
Protein Refseq | NP_001122405 |
UniProt ID | Q9UMS6 |
◆ Recombinant Proteins | ||
SYNPO2-018H | Recombinant Human SYNPO2 protein, GST-tagged | +Inquiry |
SYNPO2-6019H | Recombinant Human SYNPO2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYNPO2 Products
Required fields are marked with *
My Review for All SYNPO2 Products
Required fields are marked with *
0
Inquiry Basket