Recombinant Human TAF5 protein, GST-tagged

• Cat.No.: TAF5-2988H
• Product Overview: Recombinant Human TAF5 protein(655-800 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 655-800 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: DVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: TAF5 TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa [ Homo sapiens ]
• Official Symbol: TAF5
• Synonyms: TAF5; TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa; TAF2D, TATA box binding protein (TBP) associated factor, RNA polymerase II, D, 100kD; transcription initiation factor TFIID subunit 5; TAFII100; TAFII-100; TAF(II)100; TATA box binding protein (TBP)-associated factor 2D; transcription initiation factor TFIID 100 kD subunit; transcription initiation factor TFIID 100 kDa subunit; TATA box binding protein (TBP)-associated factor, RNA polymerase II, D, 100kD; TAF2D
• Gene ID: 6877
• mRNA Refseq: NM_006951
• Protein Refseq: NP_008882
• MIM: 601787
• UniProt ID: Q15542