Recombinant Human TAFAZZIN protein, His-tagged
| Cat.No. : | TAFAZZIN-107H |
| Product Overview : | Recombinant Human TAFAZZIN protein(NP_000107)(1-262 aa), fused with His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-262 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMASGVGGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TAFAZZIN tafazzin, phospholipid-lysophospholipid transacylase [ Homo sapiens (human) ] |
| Official Symbol | TAFAZZIN |
| Synonyms | EFE; TAZ; BTHS; EFE2; G4.5; Taz1; CMD3A; LVNCX |
| Gene ID | 6901 |
| mRNA Refseq | NM_000116.5 |
| Protein Refseq | NP_000107.1 |
| MIM | 300394 |
| UniProt ID | Q16635 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAFAZZIN Products
Required fields are marked with *
My Review for All TAFAZZIN Products
Required fields are marked with *
Recently Viewed
