Recombinant Human TAGLN3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TAGLN3-3495H |
Product Overview : | TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001008274) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TAGLN3 (Transgelin 3) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include actin filament binding. An important paralog of this gene is TAGLN2. |
Molecular Mass : | 22.5 kDa |
AA Sequence : | MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TAGLN3 transgelin 3 [ Homo sapiens (human) ] |
Official Symbol | TAGLN3 |
Synonyms | TAGLN3; transgelin 3; transgelin-3; NP22; NP25; neuronal protein 22; neuronal protein NP25; |
Gene ID | 29114 |
mRNA Refseq | NM_001008273 |
Protein Refseq | NP_001008274 |
MIM | 607953 |
UniProt ID | Q9UI15 |
◆ Recombinant Proteins | ||
TAGLN3-5580R | Recombinant Rat TAGLN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAGLN3-5921R | Recombinant Rat TAGLN3 Protein | +Inquiry |
TAGLN3-5151H | Recombinant Human TAGLN3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TAGLN3-3495H | Recombinant Human TAGLN3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TAGLN3-3500H | Recombinant Human TAGLN3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAGLN3-1260HCL | Recombinant Human TAGLN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAGLN3 Products
Required fields are marked with *
My Review for All TAGLN3 Products
Required fields are marked with *