Recombinant Human TCP11

• Cat.No.: TCP11-27007TH
• Product Overview: Recombinant fragment of Human TCP11, isoform 2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: T-complex protein 11 homolog is a protein that in humans is encoded by the TCP11 gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Expressed only in fertile adult testis.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: NTASLMGQLQNIAKKENCVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNLTHHNQQVFGPYYTEILKTLISPAQALETKVESV
• Sequence Similarities: Belongs to the TCP11 family.

Gene Information

• Gene Name: TCP11 t-complex 11 homolog (mouse) [ Homo sapiens ]
• Official Symbol: TCP11
• Synonyms: TCP11; t-complex 11 homolog (mouse); D6S230E, t complex 11 (a murine tcp homolog); T-complex protein 11 homolog; KIAA0229
• Gene ID: 6954
• mRNA Refseq: NM_001093728
• Protein Refseq: NP_001087197
• MIM: 186982
• Uniprot ID: Q8WWU5
• Chromosome Location: 6p21.31