Recombinant Human TCP11
Cat.No. : | TCP11-27007TH |
Product Overview : | Recombinant fragment of Human TCP11, isoform 2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | T-complex protein 11 homolog is a protein that in humans is encoded by the TCP11 gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed only in fertile adult testis. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NTASLMGQLQNIAKKENCVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNLTHHNQQVFGPYYTEILKTLISPAQALETKVESV |
Sequence Similarities : | Belongs to the TCP11 family. |
Gene Name | TCP11 t-complex 11 homolog (mouse) [ Homo sapiens ] |
Official Symbol | TCP11 |
Synonyms | TCP11; t-complex 11 homolog (mouse); D6S230E, t complex 11 (a murine tcp homolog); T-complex protein 11 homolog; KIAA0229; |
Gene ID | 6954 |
mRNA Refseq | NM_001093728 |
Protein Refseq | NP_001087197 |
MIM | 186982 |
Uniprot ID | Q8WWU5 |
Chromosome Location | 6p21.31 |
◆ Recombinant Proteins | ||
RFL33454HF | Recombinant Full Length Human T-Complex Protein 11 Homolog(Tcp11) Protein, His-Tagged | +Inquiry |
TCP11-27007TH | Recombinant Human TCP11 | +Inquiry |
TCP11-5993R | Recombinant Rat TCP11 Protein | +Inquiry |
TCP11-5652R | Recombinant Rat TCP11 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCP11-3164H | Recombinant Human TCP11, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCP11-1754HCL | Recombinant Human TCP11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCP11 Products
Required fields are marked with *
My Review for All TCP11 Products
Required fields are marked with *