Recombinant Human TEX37 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TEX37-5739H |
Product Overview : | C2orf51 MS Standard C13 and N15-labeled recombinant protein (NP_689883) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TEX37 (Testis Expressed 37) is a Protein Coding gene. |
Molecular Mass : | 20.6 kDa |
AA Sequence : | MAGVKYPGQDPVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNPNPKLTDGYPAFKRPHMTAKDLGLPGFFPSQEHEATREDERKFTSTCHFTYPASHDLHLAQGDPNQVLQSADFPCLVDPKHQPAAEMAKGYLLLPGCPCLHCHIVKVPILNRWGPLMPFYQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TEX37 testis expressed 37 [ Homo sapiens (human) ] |
Official Symbol | TEX37 |
Synonyms | TEX37; testis expressed 37; TSC21; C2orf51; testis-expressed sequence 37 protein; Testis-Specific Conserved gene 21kDa; protein TSC21; testis tissue sperm-binding protein Li 93mP; testis-specific conserved protein of 21 kDa |
Gene ID | 200523 |
mRNA Refseq | NM_152670 |
Protein Refseq | NP_689883 |
UniProt ID | Q96LM6 |
◆ Recombinant Proteins | ||
TEX37-652H | Recombinant Human TEX37 Protein, MYC/DDK-tagged | +Inquiry |
Tex37-6370M | Recombinant Mouse Tex37 Protein, Myc/DDK-tagged | +Inquiry |
TEX37-4491R | Recombinant Rhesus Macaque TEX37 Protein, His (Fc)-Avi-tagged | +Inquiry |
TEX37-4177H | Recombinant Human TEX37 Protein, His (Fc)-Avi-tagged | +Inquiry |
TEX37-5739H | Recombinant Human TEX37 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEX37 Products
Required fields are marked with *
My Review for All TEX37 Products
Required fields are marked with *