Recombinant Human TEX37 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TEX37-5739H
Product Overview : C2orf51 MS Standard C13 and N15-labeled recombinant protein (NP_689883) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TEX37 (Testis Expressed 37) is a Protein Coding gene.
Molecular Mass : 20.6 kDa
AA Sequence : MAGVKYPGQDPVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNPNPKLTDGYPAFKRPHMTAKDLGLPGFFPSQEHEATREDERKFTSTCHFTYPASHDLHLAQGDPNQVLQSADFPCLVDPKHQPAAEMAKGYLLLPGCPCLHCHIVKVPILNRWGPLMPFYQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TEX37 testis expressed 37 [ Homo sapiens (human) ]
Official Symbol TEX37
Synonyms TEX37; testis expressed 37; TSC21; C2orf51; testis-expressed sequence 37 protein; Testis-Specific Conserved gene 21kDa; protein TSC21; testis tissue sperm-binding protein Li 93mP; testis-specific conserved protein of 21 kDa
Gene ID 200523
mRNA Refseq NM_152670
Protein Refseq NP_689883
UniProt ID Q96LM6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TEX37 Products

Required fields are marked with *

My Review for All TEX37 Products

Required fields are marked with *

0
cart-icon
0
compare icon