Recombinant Human TKTL2 Protein, GST-tagged
| Cat.No. : | TKTL2-2646H |
| Product Overview : | Human DKFZP434L1717 partial ORF ( NP_115512, 59 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | TKTL2 (Transketolase Like 2) is a Protein Coding gene. Among its related pathways are Carbon metabolism and Metabolism. GO annotations related to this gene include oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor and transketolase activity. An important paralog of this gene is TKTL1. |
| Molecular Mass : | 32.56 kDa |
| AA Sequence : | YKQTDPEHPDNDRFILSRGHAAPILYAAWVEVGDISESDLLNLRKLHSDLERHPTPRLPFVD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TKTL2 transketolase-like 2 [ Homo sapiens ] |
| Official Symbol | TKTL2 |
| Synonyms | TKTL2; transketolase-like 2; transketolase-like protein 2; DKFZP434L1717; FLJ32975; similar to transketolase; DKFZp434L1717; |
| Gene ID | 84076 |
| mRNA Refseq | NM_032136 |
| Protein Refseq | NP_115512 |
| UniProt ID | Q9H0I9 |
| ◆ Recombinant Proteins | ||
| Tktl2-6446M | Recombinant Mouse Tktl2 Protein, Myc/DDK-tagged | +Inquiry |
| TKTL2-3250H | Recombinant Human TKTL2, GST-tagged | +Inquiry |
| TKTL2-4627H | Recombinant Human TKTL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TKTL2-1111H | Recombinant Human TKTL2 Protein, MYC/DDK-tagged | +Inquiry |
| TKTL2-2646H | Recombinant Human TKTL2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TKTL2 Products
Required fields are marked with *
My Review for All TKTL2 Products
Required fields are marked with *
