Recombinant Human TLR5 protein, GST-tagged
Cat.No. : | TLR5-989H |
Product Overview : | Recombinant Human TLR5(C-198aa) fused with GST tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 198 a.a. |
Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol. |
AA Sequence : | TKFRGFCFICYKTAQRLVFKDHPQGTEPDMYKYDAYLCFSSKDFTWVQNALLKHLDTQYSDQNRFNLCFEERDFV PGENRIANIQDAIWNSRKIVCLVSRHFLRDGWCLEAFSYAQGRCLSDLNSALIMVVVGSLSQYQLMKHQSIRGFV QKQQYLRWPEDLQDVGWFLHKLSQQILKKEKEKKKDNNIPLQTVATIS |
Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
Gene Name | TLR5 toll-like receptor 5 [ Homo sapiens ] |
Official Symbol | TLR5 |
Synonyms | TLR5; toll-like receptor 5; FLJ10052; MGC126430; MGC126431; SLEB1; TIL3; Toll/interleukin 1 receptor like protein 3; toll/interleukin-1 receptor-like protein 3; |
Gene ID | 7100 |
mRNA Refseq | NM_003268 |
Protein Refseq | NP_003259 |
MIM | 603031 |
UniProt ID | O60602 |
Chromosome Location | 1q32.3-q42 |
Pathway | Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; MyD88 cascade initiated on plasma membrane, organism-specific biosystem; Pathogenic Escherichia coli infection, organism-specific biosystem; Pathogenic Escherichia coli infection, conserved biosystem; |
Function | interleukin-1 receptor binding; receptor activity; |
◆ Recombinant Proteins | ||
TLR5-392H | Recombinant Human TLR5 protein, Fc-tagged | +Inquiry |
Tlr5-2077M | Recombinant Mouse Tlr5 protein, His & GST-tagged | +Inquiry |
TLR5-2075H | Recombinant Human TLR5 protein, His & S-tagged | +Inquiry |
TLR5-989H | Recombinant Human TLR5 protein, GST-tagged | +Inquiry |
TLR5-2190C | Recombinant Chicken TLR5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLR5-1045HCL | Recombinant Human TLR5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TLR5 Products
Required fields are marked with *
My Review for All TLR5 Products
Required fields are marked with *
0
Inquiry Basket