Recombinant Human TLR5 protein, GST-tagged

Cat.No. : TLR5-989H
Product Overview : Recombinant Human TLR5(C-198aa) fused with GST tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 198 a.a.
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
AA Sequence : TKFRGFCFICYKTAQRLVFKDHPQGTEPDMYKYDAYLCFSSKDFTWVQNALLKHLDTQYSDQNRFNLCFEERDFV PGENRIANIQDAIWNSRKIVCLVSRHFLRDGWCLEAFSYAQGRCLSDLNSALIMVVVGSLSQYQLMKHQSIRGFV QKQQYLRWPEDLQDVGWFLHKLSQQILKKEKEKKKDNNIPLQTVATIS
Storage : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name TLR5 toll-like receptor 5 [ Homo sapiens ]
Official Symbol TLR5
Synonyms TLR5; toll-like receptor 5; FLJ10052; MGC126430; MGC126431; SLEB1; TIL3; Toll/interleukin 1 receptor like protein 3; toll/interleukin-1 receptor-like protein 3;
Gene ID 7100
mRNA Refseq NM_003268
Protein Refseq NP_003259
MIM 603031
UniProt ID O60602
Chromosome Location 1q32.3-q42
Pathway Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; MyD88 cascade initiated on plasma membrane, organism-specific biosystem; Pathogenic Escherichia coli infection, organism-specific biosystem; Pathogenic Escherichia coli infection, conserved biosystem;
Function interleukin-1 receptor binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TLR5 Products

Required fields are marked with *

My Review for All TLR5 Products

Required fields are marked with *

0
cart-icon