Recombinant Human TLR5 protein, His-tagged
| Cat.No. : | TLR5-903H |
| Product Overview : | Recombinant Human TLR5(C-198aa) fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 198 a.a. |
| Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol. |
| AA Sequence : | TKFRGFCFICYKTAQRLVFKDHPQGTEPDMYKYDAYLCFSSKDFTWVQNALLKHLDTQYSDQNRFNLCFEERDFV PGENRIANIQDAIWNSRKIVCLVSRHFLRDGWCLEAFSYAQGRCLSDLNSALIMVVVGSLSQYQLMKHQSIRGFV QKQQYLRWPEDLQDVGWFLHKLSQQILKKEKEKKKDNNIPLQTVATIS |
| Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
| Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
| Gene Name | TLR5 toll-like receptor 5 [ Homo sapiens ] |
| Official Symbol | TLR5 |
| Synonyms | TLR5; toll-like receptor 5; FLJ10052; MGC126430; MGC126431; SLEB1; TIL3; Toll/interleukin 1 receptor like protein 3; toll/interleukin-1 receptor-like protein 3; |
| Gene ID | 7100 |
| mRNA Refseq | NM_003268 |
| Protein Refseq | NP_003259 |
| MIM | 603031 |
| UniProt ID | O60602 |
| Chromosome Location | 1q32.3-q42 |
| Pathway | Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; MyD88 cascade initiated on plasma membrane, organism-specific biosystem; Pathogenic Escherichia coli infection, organism-specific biosystem; Pathogenic Escherichia coli infection, conserved biosystem; |
| Function | interleukin-1 receptor binding; receptor activity; |
| ◆ Recombinant Proteins | ||
| TLR5-2038H | Active Recombinant Human TLR5 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
| TLR5-2076H | Recombinant Human TLR5 protein, His-tagged | +Inquiry |
| Tlr5-2077M | Recombinant Mouse Tlr5 protein, His & GST-tagged | +Inquiry |
| TLR5-989H | Recombinant Human TLR5 protein, GST-tagged | +Inquiry |
| TLR5-2190C | Recombinant Chicken TLR5 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TLR5-1045HCL | Recombinant Human TLR5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TLR5 Products
Required fields are marked with *
My Review for All TLR5 Products
Required fields are marked with *
