Recombinant Human TMEM101 Protein, GST-tagged

• Cat.No.: TMEM101-5287H
• Product Overview: Human MGC4251 full-length ORF ( AAH07438, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: TMEM101 (Transmembrane Protein 101) is a Protein Coding gene. GO annotations related to this gene include signal transducer activity.
• Molecular Mass: 54.01 kDa
• AA Sequence: MASKVGSRRWMLQLIMQLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMGAAVLCASFMSFGVKRRWFALGAALQLAISTYAAYIGGYVHYGDWLKVRMYSRTVAIIGGFLVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVAYSLQHSKEDRLAYLNHLPGGELMIQLLFVLYGILALAFLSGYYVTLAAQILAVLLPPVMLLIDGNVAYWHNTRRVEFWNQMKLLGESVGIFGTAVILATDG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TMEM101 transmembrane protein 101 [ Homo sapiens ]
• Official Symbol: TMEM101
• Synonyms: TMEM101; transmembrane protein 101; FLJ23987; MGC4251; putative NF-kappa-B-activating protein 130
• Gene ID: 84336
• mRNA Refseq: NM_032376
• Protein Refseq: NP_115752
• UniProt ID: Q96IK0