Recombinant Human TMEM101 Protein, GST-tagged

Cat.No. : TMEM101-5287H
Product Overview : Human MGC4251 full-length ORF ( AAH07438, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : TMEM101 (Transmembrane Protein 101) is a Protein Coding gene. GO annotations related to this gene include signal transducer activity.
Molecular Mass : 54.01 kDa
AA Sequence : MASKVGSRRWMLQLIMQLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMGAAVLCASFMSFGVKRRWFALGAALQLAISTYAAYIGGYVHYGDWLKVRMYSRTVAIIGGFLVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVAYSLQHSKEDRLAYLNHLPGGELMIQLLFVLYGILALAFLSGYYVTLAAQILAVLLPPVMLLIDGNVAYWHNTRRVEFWNQMKLLGESVGIFGTAVILATDG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TMEM101 transmembrane protein 101 [ Homo sapiens ]
Official Symbol TMEM101
Synonyms TMEM101; transmembrane protein 101; FLJ23987; MGC4251; putative NF-kappa-B-activating protein 130;
Gene ID 84336
mRNA Refseq NM_032376
Protein Refseq NP_115752
UniProt ID Q96IK0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMEM101 Products

Required fields are marked with *

My Review for All TMEM101 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon