Recombinant Human TMEM101 Protein, GST-tagged
Cat.No. : | TMEM101-5287H |
Product Overview : | Human MGC4251 full-length ORF ( AAH07438, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | TMEM101 (Transmembrane Protein 101) is a Protein Coding gene. GO annotations related to this gene include signal transducer activity. |
Molecular Mass : | 54.01 kDa |
AA Sequence : | MASKVGSRRWMLQLIMQLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMGAAVLCASFMSFGVKRRWFALGAALQLAISTYAAYIGGYVHYGDWLKVRMYSRTVAIIGGFLVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVAYSLQHSKEDRLAYLNHLPGGELMIQLLFVLYGILALAFLSGYYVTLAAQILAVLLPPVMLLIDGNVAYWHNTRRVEFWNQMKLLGESVGIFGTAVILATDG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TMEM101 transmembrane protein 101 [ Homo sapiens ] |
Official Symbol | TMEM101 |
Synonyms | TMEM101; transmembrane protein 101; FLJ23987; MGC4251; putative NF-kappa-B-activating protein 130; |
Gene ID | 84336 |
mRNA Refseq | NM_032376 |
Protein Refseq | NP_115752 |
UniProt ID | Q96IK0 |
◆ Recombinant Proteins | ||
TMEM101-6421HF | Recombinant Full Length Human TMEM101 Protein, GST-tagged | +Inquiry |
TMEM101-4572R | Recombinant Rhesus Macaque TMEM101 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM101-3883C | Recombinant Chicken TMEM101 | +Inquiry |
TMEM101-5287H | Recombinant Human TMEM101 Protein, GST-tagged | +Inquiry |
TMEM101-4758R | Recombinant Rhesus monkey TMEM101 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM101 Products
Required fields are marked with *
My Review for All TMEM101 Products
Required fields are marked with *