Recombinant Human TMEM72 Full Length Transmembrane protein, His & Myc-tagged
| Cat.No. : | TMEM72-1038H |
| Product Overview : | Recombinant Human TMEM72 protein(A0PK05)(1-275aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-275aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 36.9 kDa |
| AA Sequence : | MQLQVFWTGLEYTCRLLGITTAAVLIGVGTETFLQGQFKSLAFYLLFTGAAVSICEGAYFVAQLLAICFQCQPGSLADRVREKAHWLGCFQKFLAYLLLSVACFLHPVLVWHVTIPGSMLIITGLAYFLLSKRKKRKAAPEVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSALQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLDDGDSEPEETTSDTTPIIPPPQAPLFLSSLTATGLF |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | TMEM72 transmembrane protein 72 [ Homo sapiens ] |
| Official Symbol | TMEM72 |
| Synonyms | KSP37; C10orf127; bA285G1.3 |
| Gene ID | 643236 |
| mRNA Refseq | NM_001123376.1 |
| Protein Refseq | NP_001116848.1 |
| UniProt ID | A0PK05 |
| ◆ Cell & Tissue Lysates | ||
| TMEM72-691HCL | Recombinant Human TMEM72 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM72 Products
Required fields are marked with *
My Review for All TMEM72 Products
Required fields are marked with *



