Recombinant Human TMEM72 Full Length Transmembrane protein, His & Myc-tagged

• Cat.No.: TMEM72-1038H
• Product Overview: Recombinant Human TMEM72 protein(A0PK05)(1-275aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in in vitro E. coli expression system.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-275aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.9 kDa
• AA Sequence: MQLQVFWTGLEYTCRLLGITTAAVLIGVGTETFLQGQFKSLAFYLLFTGAAVSICEGAYFVAQLLAICFQCQPGSLADRVREKAHWLGCFQKFLAYLLLSVACFLHPVLVWHVTIPGSMLIITGLAYFLLSKRKKRKAAPEVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSALQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLDDGDSEPEETTSDTTPIIPPPQAPLFLSSLTATGLF
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: TMEM72 transmembrane protein 72 [ Homo sapiens ]
• Official Symbol: TMEM72
• Synonyms: KSP37; C10orf127; bA285G1.3
• Gene ID: 643236
• mRNA Refseq: NM_001123376.1
• Protein Refseq: NP_001116848.1
• UniProt ID: A0PK05