Recombinant Human TMEM72 Full Length Transmembrane protein, His & Myc-tagged

Cat.No. : TMEM72-1038H
Product Overview : Recombinant Human TMEM72 protein(A0PK05)(1-275aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in in vitro E. coli expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 1-275aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 36.9 kDa
AA Sequence : MQLQVFWTGLEYTCRLLGITTAAVLIGVGTETFLQGQFKSLAFYLLFTGAAVSICEGAYFVAQLLAICFQCQPGSLADRVREKAHWLGCFQKFLAYLLLSVACFLHPVLVWHVTIPGSMLIITGLAYFLLSKRKKRKAAPEVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSALQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLDDGDSEPEETTSDTTPIIPPPQAPLFLSSLTATGLF
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name TMEM72 transmembrane protein 72 [ Homo sapiens ]
Official Symbol TMEM72
Synonyms KSP37; C10orf127; bA285G1.3
Gene ID 643236
mRNA Refseq NM_001123376.1
Protein Refseq NP_001116848.1
UniProt ID A0PK05

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMEM72 Products

Required fields are marked with *

My Review for All TMEM72 Products

Required fields are marked with *

0
cart-icon
0
compare icon