Recombinant Human TOMM20 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TOMM20-443H |
Product Overview : | TOMM20 MS Standard C13 and N15-labeled recombinant protein (NP_055580) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore. Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases. |
Molecular Mass : | 16.3 kDa |
AA Sequence : | MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TOMM20 translocase of outer mitochondrial membrane 20 [ Homo sapiens (human) ] |
Official Symbol | TOMM20 |
Synonyms | TOMM20; translocase of outer mitochondrial membrane 20 homolog (yeast); mitochondrial import receptor subunit TOM20 homolog; KIAA0016; MAS20; MOM19; TOM20; translocase of outer mitochondrial membrane 20 homolog type II; mitochondrial 20 kDa outer membrane protein; outer mitochondrial membrane receptor Tom20; MGC117367 |
Gene ID | 9804 |
mRNA Refseq | NM_014765 |
Protein Refseq | NP_055580 |
MIM | 601848 |
UniProt ID | Q15388 |
◆ Recombinant Proteins | ||
TOMM20-7601H | Recombinant Human TOMM20, His-tagged | +Inquiry |
Tomm20-6581M | Recombinant Mouse Tomm20 Protein, Myc/DDK-tagged | +Inquiry |
TOMM20-5873R | Recombinant Rat TOMM20 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL2041BF | Recombinant Full Length Bovine Mitochondrial Import Receptor Subunit Tom20 Homolog(Tomm20) Protein, His-Tagged | +Inquiry |
TOMM20-4706R | Recombinant Rhesus Macaque TOMM20 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TOMM20-872HCL | Recombinant Human TOMM20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOMM20 Products
Required fields are marked with *
My Review for All TOMM20 Products
Required fields are marked with *