Recombinant Human TOMM20 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TOMM20-443H
Product Overview : TOMM20 MS Standard C13 and N15-labeled recombinant protein (NP_055580) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore. Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases.
Molecular Mass : 16.3 kDa
AA Sequence : MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TOMM20 translocase of outer mitochondrial membrane 20 [ Homo sapiens (human) ]
Official Symbol TOMM20
Synonyms TOMM20; translocase of outer mitochondrial membrane 20 homolog (yeast); mitochondrial import receptor subunit TOM20 homolog; KIAA0016; MAS20; MOM19; TOM20; translocase of outer mitochondrial membrane 20 homolog type II; mitochondrial 20 kDa outer membrane protein; outer mitochondrial membrane receptor Tom20; MGC117367
Gene ID 9804
mRNA Refseq NM_014765
Protein Refseq NP_055580
MIM 601848
UniProt ID Q15388

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TOMM20 Products

Required fields are marked with *

My Review for All TOMM20 Products

Required fields are marked with *

0
cart-icon