Recombinant Human TPP2 protein, His&Myc-tagged

• Cat.No.: TPP2-4606H
• Product Overview: Recombinant Human TPP2 protein(P29144)(44-264aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 44-264aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 31.8 kDa
• AA Sequence: DTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: TPP2 tripeptidyl peptidase II [ Homo sapiens ]
• Official Symbol: TPP2
• Synonyms: TPP2; tripeptidyl peptidase II; tripeptidyl-peptidase 2; TPP-II; tripeptidyl-peptidase II; tripeptidyl aminopeptidase; TPP-2; FLJ40359
• Gene ID: 7174
• mRNA Refseq: NM_003291
• Protein Refseq: NP_003282
• MIM: 190470
• UniProt ID: P29144