Recombinant Human TPTE2 protein, GST-tagged

Cat.No. : TPTE2-30141H
Product Overview : Recombinant Human TPTE2 (1-62 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Thr62
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MNESPQTNEFKGTTEEAPAKESPHTSEFKGAALVSPISKSMLERLSKFEVEDAENVASYEWT
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name TPTE2 transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [ Homo sapiens (human) ]
Official Symbol TPTE2
Synonyms TPTE2; TPIP
Gene ID 93492
mRNA Refseq NM_001141968
Protein Refseq NP_001135440
MIM 606791
UniProt ID Q6XPS3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TPTE2 Products

Required fields are marked with *

My Review for All TPTE2 Products

Required fields are marked with *

0
cart-icon