Recombinant Human TRAF6 protein, GST-tagged

• Cat.No.: TRAF6-31603TH
• Product Overview: Recombinant Human TRAF6(413 a.a. - 522 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 413-522 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.84 kDa
• AA Sequence: TMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTF IKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: TRAF6 TNF receptor-associated factor 6, E3 ubiquitin protein ligase [ Homo sapiens ]
• Official Symbol: TRAF6
• Synonyms: TRAF6; TNF receptor-associated factor 6, E3 ubiquitin protein ligase; TNF receptor associated factor 6; TNF receptor-associated factor 6; RNF85; RING finger protein 85; interleukin-1 signal transducer; E3 ubiquitin-protein ligase TRAF6; MGC:3310
• Gene ID: 7189
• mRNA Refseq: NM_004620
• Protein Refseq: NP_004611
• MIM: 602355
• UniProt ID: Q9Y4K3
• Chromosome Location: 11p12
• Pathway: Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; BCR signaling pathway, organism-specific biosystem; CD40/CD40L signaling, organism-specific biosystem; Canonical NF-kappaB pathway, organism-specific biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem
• Function: histone deacetylase binding; ligase activity; metal ion binding; mitogen-activated protein kinase kinase kinase binding; protein N-terminus binding; protein binding; protein kinase B binding; protein kinase binding; ubiquitin-protein ligase activity; ubiquitin-protein ligase activity; ubiquitin-protein ligase activity; zinc ion binding