Recombinant Human TRAF6 protein, GST-tagged
Cat.No. : | TRAF6-31603TH |
Product Overview : | Recombinant Human TRAF6(413 a.a. - 522 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 413-522 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | TMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTF IKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TRAF6 TNF receptor-associated factor 6, E3 ubiquitin protein ligase [ Homo sapiens ] |
Official Symbol | TRAF6 |
Synonyms | TRAF6; TNF receptor-associated factor 6, E3 ubiquitin protein ligase; TNF receptor associated factor 6; TNF receptor-associated factor 6; RNF85; RING finger protein 85; interleukin-1 signal transducer; E3 ubiquitin-protein ligase TRAF6; MGC:3310; |
Gene ID | 7189 |
mRNA Refseq | NM_004620 |
Protein Refseq | NP_004611 |
MIM | 602355 |
UniProt ID | Q9Y4K3 |
Chromosome Location | 11p12 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; BCR signaling pathway, organism-specific biosystem; CD40/CD40L signaling, organism-specific biosystem; Canonical NF-kappaB pathway, organism-specific biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; |
Function | histone deacetylase binding; ligase activity; metal ion binding; mitogen-activated protein kinase kinase kinase binding; protein N-terminus binding; protein binding; protein kinase B binding; protein kinase binding; ubiquitin-protein ligase activity; ubiquitin-protein ligase activity; ubiquitin-protein ligase activity; zinc ion binding; |
◆ Recombinant Proteins | ||
TRAF6-9560M | Recombinant Mouse TRAF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRAF6-3143H | Recombinant Human TRAF6 Protein, GST-tagged | +Inquiry |
TRAF6-481C | Recombinant Chicken TRAF6 Protein, His-tagged | +Inquiry |
Traf6-556M | Recombinant Mouse Traf6 Protein, His-tagged | +Inquiry |
TRAF6-105HFL | Active Recombinant Full Length Human TRAF6 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRAF6-817HCL | Recombinant Human TRAF6 293 Cell Lysate | +Inquiry |
TRAF6-818HCL | Recombinant Human TRAF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAF6 Products
Required fields are marked with *
My Review for All TRAF6 Products
Required fields are marked with *