Recombinant Human TRIP4 protein, GST-tagged
| Cat.No. : | TRIP4-5353H |
| Product Overview : | Recombinant Human TRIP4 protein(282-581 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 282-581 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | VIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLAEYHSRLDETIQAIANGTLNQPLTKLDRSSEEPLGVLVNPNMYQSPPQWVDHTGAASQKKAFRSSGFGLEFNSFQHQLRIQDQEFQEGFDGGWCLSVHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFKEQFPDISQESDSPFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMKQNKAV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | TRIP4 thyroid hormone receptor interactor 4 [ Homo sapiens ] |
| Official Symbol | TRIP4 |
| Synonyms | TRIP4; thyroid hormone receptor interactor 4; activating signal cointegrator 1; HsT17391; TRIP-4; TR-interacting protein 4; thyroid receptor interacting protein 4; thyroid receptor-interacting protein 4; ASC1; ASC-1; |
| Gene ID | 9325 |
| mRNA Refseq | NM_016213 |
| Protein Refseq | NP_057297 |
| MIM | 604501 |
| UniProt ID | Q15650 |
| ◆ Recombinant Proteins | ||
| TRIP4-4790R | Recombinant Rhesus Macaque TRIP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TRIP4-3423H | Recombinant Human TRIP4, GST-tagged | +Inquiry |
| TRIP4-4784Z | Recombinant Zebrafish TRIP4 | +Inquiry |
| TRIP4-5353H | Recombinant Human TRIP4 protein, GST-tagged | +Inquiry |
| TRIP4-17410M | Recombinant Mouse TRIP4 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRIP4-703HCL | Recombinant Human TRIP4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIP4 Products
Required fields are marked with *
My Review for All TRIP4 Products
Required fields are marked with *
