Recombinant Human TRMT2B protein, His-tagged
Cat.No. : | TRMT2B-3503H |
Product Overview : | Recombinant Human TRMT2B protein(89-247 aa), fused to His tag, was expressed in E. coli. |
Availability | October 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 89-247 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | TPLWRLSYEEQLKVKFAAQKKILQRLESYIQMLNGVSVTTAVPKSERLSCLLHPIIPSPVINGYRNKSTFSVNRGPDGNPKTVGFYLGTWRDGNVVCVQSNHLKNIPEKHSQVAQYYEVFLRQSPLEPCLVFHEGGYWRELTVRTNSQGHTMAIITFHP |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TRMT2B TRM2 tRNA methyltransferase 2 homolog B (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | TRMT2B |
Synonyms | TRMT2B; TRM2 tRNA methyltransferase 2 homolog B (S. cerevisiae); chromosome X open reading frame 34 , CXorf34; tRNA (uracil(54)-C(5))-methyltransferase homolog; FLJ12687; TRM2 homolog; tRNA (uracil-5-)-methyltransferase homolog; CXorf34; dJ341D10.3; |
Gene ID | 79979 |
mRNA Refseq | NM_001167970 |
Protein Refseq | NP_001161442 |
UniProt ID | Q96GJ1 |
◆ Recombinant Proteins | ||
TRMT2B-17421M | Recombinant Mouse TRMT2B Protein | +Inquiry |
TRMT2B-9639M | Recombinant Mouse TRMT2B Protein, His (Fc)-Avi-tagged | +Inquiry |
TRMT2B-2336HF | Recombinant Full Length Human TRMT2B Protein, GST-tagged | +Inquiry |
TRMT2B-3427H | Recombinant Human TRMT2B, GST-tagged | +Inquiry |
TRMT2B-3503H | Recombinant Human TRMT2B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRMT2B-427HCL | Recombinant Human TRMT2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRMT2B Products
Required fields are marked with *
My Review for All TRMT2B Products
Required fields are marked with *