Recombinant Human TROVE2 protein(21-369 aa), His-tagged

Cat.No. : TROVE2-3431H
Product Overview : Recombinant Human TROVE2 protein(21-369 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 21-369 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : DGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGK
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name TROVE2 TROVE domain family, member 2 [ Homo sapiens ]
Official Symbol TROVE2
Synonyms TROVE2; TROVE domain family, member 2; Sjogren syndrome antigen A2 (60kDa, ribonucleoprotein autoantigen SS A/Ro) , SSA2; 60 kDa SS-A/Ro ribonucleoprotein; 60 kDa ribonucleoprotein Ro; sjoegren syndrome type A antigen; gastric cancer multi-drug resistance protein; Sjogren syndrome antigen A2 (60kD, ribonucleoprotein autoantigen SS-A/Ro); RO60; SSA2; RORNP;
Gene ID 6738
mRNA Refseq NM_001042369
Protein Refseq NP_001035828
MIM 600063
UniProt ID P10155

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TROVE2 Products

Required fields are marked with *

My Review for All TROVE2 Products

Required fields are marked with *

0
cart-icon
0
compare icon