Recombinant Human TROVE2 protein(21-369 aa), His-tagged

• Cat.No.: TROVE2-3431H
• Product Overview: Recombinant Human TROVE2 protein(21-369 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 21-369 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: DGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
  After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: TROVE2 TROVE domain family, member 2 [ Homo sapiens ]
• Official Symbol: TROVE2
• Synonyms: TROVE2; TROVE domain family, member 2; Sjogren syndrome antigen A2 (60kDa, ribonucleoprotein autoantigen SS A/Ro) , SSA2; 60 kDa SS-A/Ro ribonucleoprotein; 60 kDa ribonucleoprotein Ro; sjoegren syndrome type A antigen; gastric cancer multi-drug resistance protein; Sjogren syndrome antigen A2 (60kD, ribonucleoprotein autoantigen SS-A/Ro); RO60; SSA2; RORNP
• Gene ID: 6738
• mRNA Refseq: NM_001042369
• Protein Refseq: NP_001035828
• MIM: 600063
• UniProt ID: P10155