Recombinant Human TROVE2 protein(21-369 aa), His-tagged
Cat.No. : | TROVE2-3431H |
Product Overview : | Recombinant Human TROVE2 protein(21-369 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-369 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | DGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | TROVE2 TROVE domain family, member 2 [ Homo sapiens ] |
Official Symbol | TROVE2 |
Synonyms | TROVE2; TROVE domain family, member 2; Sjogren syndrome antigen A2 (60kDa, ribonucleoprotein autoantigen SS A/Ro) , SSA2; 60 kDa SS-A/Ro ribonucleoprotein; 60 kDa ribonucleoprotein Ro; sjoegren syndrome type A antigen; gastric cancer multi-drug resistance protein; Sjogren syndrome antigen A2 (60kD, ribonucleoprotein autoantigen SS-A/Ro); RO60; SSA2; RORNP; |
Gene ID | 6738 |
mRNA Refseq | NM_001042369 |
Protein Refseq | NP_001035828 |
MIM | 600063 |
UniProt ID | P10155 |
◆ Recombinant Proteins | ||
TROVE2-1051C | Recombinant Cynomolgus TROVE2 Protein, His-tagged | +Inquiry |
TROVE2-3430H | Recombinant Human TROVE2, GST-tagged | +Inquiry |
TROVE2-3431H | Recombinant Human TROVE2 protein(21-369 aa), His-tagged | +Inquiry |
Trove2-3624M | Recombinant Mouse Trove2 protein, His-SUMO & Myc-tagged | +Inquiry |
TROVE2-3522Z | Recombinant Zebrafish TROVE2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TROVE2-747HCL | Recombinant Human TROVE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TROVE2 Products
Required fields are marked with *
My Review for All TROVE2 Products
Required fields are marked with *