Recombinant Human TRPM5 Protein, His-tagged

• Cat.No.: TRPM5-31H
• Product Overview: Recombinant Human TRPM5 Protein(Q9NZQ8)(321-440 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 321-440 aa
• Form: Phosphate buffered saline
• Molecular Mass: 16 kDa
• AASequence: EGSEELDTVILKALVKACKSHSQEPQDYLDELKLAVAWDRVDIAKSEIFNGDVEWKSCDLEEVMVDALVSNKPEFVRLFVDNGADVADFLTYGRLQELYRSVSRKSLLFDLLQRKQEEAR
• Storage: Store at -20°C/-80°C.
• Reconstitution: It is recommended to redissolve in sterile deionized water.

Gene Information

• Gene Name: TRPM5 transient receptor potential cation channel, subfamily M, member 5 [ Homo sapiens ]
• Official Symbol: TRPM5
• Synonyms: TRPM5; transient receptor potential cation channel, subfamily M, member 5; transient receptor potential cation channel subfamily M member 5; LTRPC5; MTR1; LTrpC-5; MLSN1 and TRP-related; MLSN1- and TRP-related gene 1 protein; long transient receptor potential channel 5
• Gene ID: 29850
• mRNA Refseq: NM_014555
• Protein Refseq: NP_055370
• MIM: 604600
• UniProt ID: Q9NZQ8