Recombinant Human TRPM8 protein, His-tagged

Cat.No. : TRPM8-3702H
Product Overview : Recombinant Human TRPM8 protein(3-192 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability January 16, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 3-192 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
Purity : 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : SFLPVHTIVLIRENVCKCGYAQSQHMEGTQINQSEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYIRLSCDTDAEILYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWILTGGTHYGLMKYIGEVVRDNTISRSSEENIVAIGIAAWGMVSNRDTLIRNCDAEVPVGQEEVC
Gene Name TRPM8 transient receptor potential cation channel, subfamily M, member 8 [ Homo sapiens ]
Official Symbol TRPM8
Synonyms TRPM8; transient receptor potential cation channel, subfamily M, member 8; transient receptor potential cation channel subfamily M member 8; trp-p8; LTrpC-6; transient receptor potential p8; short form of the TRPM8 cationic channel; long transient receptor potential channel 6; transient receptor potential subfamily M member 8; TRPP8; LTRPC6; MGC2849
Gene ID 79054
mRNA Refseq NM_024080
Protein Refseq NP_076985
MIM 606678
UniProt ID Q7Z2W7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRPM8 Products

Required fields are marked with *

My Review for All TRPM8 Products

Required fields are marked with *

0
cart-icon
0
compare icon