Recombinant Human TRPM8 protein, His-tagged
| Cat.No. : | TRPM8-3702H |
| Product Overview : | Recombinant Human TRPM8 protein(3-192 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | August 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 3-192 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | SFLPVHTIVLIRENVCKCGYAQSQHMEGTQINQSEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYIRLSCDTDAEILYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWILTGGTHYGLMKYIGEVVRDNTISRSSEENIVAIGIAAWGMVSNRDTLIRNCDAEVPVGQEEVC |
| Gene Name | TRPM8 transient receptor potential cation channel, subfamily M, member 8 [ Homo sapiens ] |
| Official Symbol | TRPM8 |
| Synonyms | TRPM8; transient receptor potential cation channel, subfamily M, member 8; transient receptor potential cation channel subfamily M member 8; trp-p8; LTrpC-6; transient receptor potential p8; short form of the TRPM8 cationic channel; long transient receptor potential channel 6; transient receptor potential subfamily M member 8; TRPP8; LTRPC6; MGC2849 |
| Gene ID | 79054 |
| mRNA Refseq | NM_024080 |
| Protein Refseq | NP_076985 |
| MIM | 606678 |
| UniProt ID | Q7Z2W7 |
| ◆ Recombinant Proteins | ||
| TRPM8-1733C | Recombinant Chicken TRPM8 | +Inquiry |
| TRPM8-36H | Recombinant Human TRPM8 protein, His-tagged | +Inquiry |
| TRPM8-1170HFL | Recombinant Human TRPM8 protein, His&Flag-tagged | +Inquiry |
| TRPM8-35H | Recombinant Human TRPM8 protein, His-tagged | +Inquiry |
| TRPM8-3702H | Recombinant Human TRPM8 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRPM8-737HCL | Recombinant Human TRPM8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRPM8 Products
Required fields are marked with *
My Review for All TRPM8 Products
Required fields are marked with *



