Recombinant Human TRPM8 protein, His-tagged
Cat.No. : | TRPM8-3702H |
Product Overview : | Recombinant Human TRPM8 protein(3-192 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 3-192 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | SFLPVHTIVLIRENVCKCGYAQSQHMEGTQINQSEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYIRLSCDTDAEILYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWILTGGTHYGLMKYIGEVVRDNTISRSSEENIVAIGIAAWGMVSNRDTLIRNCDAEVPVGQEEVC |
Gene Name | TRPM8 transient receptor potential cation channel, subfamily M, member 8 [ Homo sapiens ] |
Official Symbol | TRPM8 |
Synonyms | TRPM8; transient receptor potential cation channel, subfamily M, member 8; transient receptor potential cation channel subfamily M member 8; trp-p8; LTrpC-6; transient receptor potential p8; short form of the TRPM8 cationic channel; long transient receptor potential channel 6; transient receptor potential subfamily M member 8; TRPP8; LTRPC6; MGC2849 |
Gene ID | 79054 |
mRNA Refseq | NM_024080 |
Protein Refseq | NP_076985 |
MIM | 606678 |
UniProt ID | Q7Z2W7 |
◆ Recombinant Proteins | ||
TRPM8-3436H | Recombinant Human TRPM8, GST-tagged | +Inquiry |
TRPM8-06H | Recombinant Human TRPM8 Protein (Met1-Pro300), N-His-tagged | +Inquiry |
TRPM8-1171H | Recombinant Human TRPM8 protein, His-tagged | +Inquiry |
TRPM8-1733C | Recombinant Chicken TRPM8 | +Inquiry |
TRPM8-6302R | Recombinant Rat TRPM8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRPM8-737HCL | Recombinant Human TRPM8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRPM8 Products
Required fields are marked with *
My Review for All TRPM8 Products
Required fields are marked with *