"TULP2" Related Products

Recombinant Human TULP2 protein, T7/His-tagged

Cat.No.: TULP2-233H
Product Overview: Recombinant human TULP2 cDNA (2 – 520 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFSQDNDTLMRDILGHELAAMRLQKLEQQRRLFEKKQRQKRQELLMVQ ANPDASPWLWRSCLREERLLGDRGLGNPFLRKKVSEAHLPSGIHSALGTVSCGGDGRGERGLPTPRTEAVFRNLG LQSPFLSWLPDNSDAELEEVSVENGSVSPPPFKQSPRIRRKGWQAHQRPGTRAEGESDSQDMGDAHKSPNMGPNP GMDGDCVYENLAFQKEEDLEKKREASESTGTNSSAAHNEELSKALKGEGGTDSDHMRHEASLAIRSPCPGLEEDM EAYVLRPALPGTMMQCYLTRDKHGVDKGLFPLYYLYLETSDSLQRFLLAGRKRRRSKTSNYLISLDPTHLSRDGD NFVGKVRSNVFSTKFTIFDNGVNPDREHLTRNTARIRQELGAVCYEPNVLGYLGPRKMTVILPGTNSQNQRINVQ PLNEQESLLSRYQRGDKQGLLLLHNKTPSWDKENGVYTLNFHGRVTRASVKNFQIVDPKHQEHLVLQFGRVGPDT FTMDFCFPFSPLQAFSICLSSFN
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: TULP2 tubby like protein 2 [ Homo sapiens ]
Official Symbol: TULP2
Synonyms: TULP2; tub; tubby-related protein 2; cancer/testis antigen 65; CT65; TUBL2; tubby-like protein 2; cancer testis antigen 65;
Gene ID: 7288
mRNA Refseq: NM_003323
Protein Refseq: NP_003314
MIM: 602309
UniProt ID: O00295
Chromosome Location: 19q13.1

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.