Recombinant Human TUSC1, His-tagged
Cat.No. : | TUSC1-31634TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 59-212 of Human TUSC1 with N terminal His tag; Predicted MWt 19 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 59-212 a.a. |
Description : | This gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 118 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QQLEERFADLAASHLEAIRARDEWDRQNARLRQENARLRL ENRRLKRENRSLFRQALRLPGEGGNGTPAEARRVPEEA STNRRARDSGREDEPGSPRALRARLEKLEAMYRRALLQ LHLEQRGPRPSGDKEEQPLQEPDSGLRSRDSEPSGPWL |
Gene Name | TUSC1 tumor suppressor candidate 1 [ Homo sapiens ] |
Official Symbol | TUSC1 |
Synonyms | TUSC1; tumor suppressor candidate 1; tumor suppressor candidate gene 1 protein; TSG 9; |
Gene ID | 286319 |
mRNA Refseq | NM_001004125 |
Protein Refseq | NP_001004125 |
MIM | 610529 |
Uniprot ID | Q2TAM9 |
Chromosome Location | 9p21.2 |
◆ Recombinant Proteins | ||
TUSC1-5030R | Recombinant Rhesus monkey TUSC1 Protein, His-tagged | +Inquiry |
TUSC1-31634TH | Recombinant Human TUSC1, His-tagged | +Inquiry |
TUSC1-9773M | Recombinant Mouse TUSC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TUSC1-4843R | Recombinant Rhesus Macaque TUSC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TUSC1-17637M | Recombinant Mouse TUSC1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TUSC1 Products
Required fields are marked with *
My Review for All TUSC1 Products
Required fields are marked with *
0
Inquiry Basket