Recombinant Human TUSC1, His-tagged
| Cat.No. : | TUSC1-31634TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 59-212 of Human TUSC1 with N terminal His tag; Predicted MWt 19 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 59-212 a.a. |
| Description : | This gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 118 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | QQLEERFADLAASHLEAIRARDEWDRQNARLRQENARLRL ENRRLKRENRSLFRQALRLPGEGGNGTPAEARRVPEEA STNRRARDSGREDEPGSPRALRARLEKLEAMYRRALLQ LHLEQRGPRPSGDKEEQPLQEPDSGLRSRDSEPSGPWL |
| Gene Name | TUSC1 tumor suppressor candidate 1 [ Homo sapiens ] |
| Official Symbol | TUSC1 |
| Synonyms | TUSC1; tumor suppressor candidate 1; tumor suppressor candidate gene 1 protein; TSG 9; |
| Gene ID | 286319 |
| mRNA Refseq | NM_001004125 |
| Protein Refseq | NP_001004125 |
| MIM | 610529 |
| Uniprot ID | Q2TAM9 |
| Chromosome Location | 9p21.2 |
| ◆ Recombinant Proteins | ||
| TUSC1-4843R | Recombinant Rhesus Macaque TUSC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TUSC1-17637M | Recombinant Mouse TUSC1 Protein | +Inquiry |
| TUSC1-5030R | Recombinant Rhesus monkey TUSC1 Protein, His-tagged | +Inquiry |
| TUSC1-31634TH | Recombinant Human TUSC1, His-tagged | +Inquiry |
| TUSC1-9773M | Recombinant Mouse TUSC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TUSC1 Products
Required fields are marked with *
My Review for All TUSC1 Products
Required fields are marked with *
