Recombinant Human TUSC1, His-tagged
Cat.No. : | TUSC1-31634TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 59-212 of Human TUSC1 with N terminal His tag; Predicted MWt 19 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 118 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QQLEERFADLAASHLEAIRARDEWDRQNARLRQENARLRL ENRRLKRENRSLFRQALRLPGEGGNGTPAEARRVPEEA STNRRARDSGREDEPGSPRALRARLEKLEAMYRRALLQ LHLEQRGPRPSGDKEEQPLQEPDSGLRSRDSEPSGPWL |
Gene Name : | TUSC1 tumor suppressor candidate 1 [ Homo sapiens ] |
Official Symbol : | TUSC1 |
Synonyms : | TUSC1; tumor suppressor candidate 1; tumor suppressor candidate gene 1 protein; TSG 9; |
Gene ID : | 286319 |
mRNA Refseq : | NM_001004125 |
Protein Refseq : | NP_001004125 |
MIM : | 610529 |
Uniprot ID : | Q2TAM9 |
Chromosome Location : | 9p21.2 |
Products Types
◆ Recombinant Protein | ||
TUSC1-4843R | Recombinant Rhesus Macaque TUSC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TUSC1-9773M | Recombinant Mouse TUSC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TUSC1-17637M | Recombinant Mouse TUSC1 Protein | +Inquiry |
TUSC1-5030R | Recombinant Rhesus monkey TUSC1 Protein, His-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket