Recombinant Human UBALD1 Protein, GST-tagged

Cat.No. : UBALD1-3659H
Product Overview : Human FAM100A full-length ORF ( NP_660296.1, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : UBALD1 (UBA Like Domain Containing 1) is a Protein Coding gene. An important paralog of this gene is UBALD2.
Molecular Mass : 45.4 kDa
AA Sequence : MSVNMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYSHHHHQMMCTPANTPATPPNFPDALTMFSRLKASESFHSGGSGSPMAATATSPPPHFPHAATSSSAASSWPTAASPPGGPQHHQPQPPLWTPTPPSPASDWPPLAPQQATSEPRAHPAMEAER
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name UBALD1 UBA like domain containing 1 [ Homo sapiens (human) ]
Official Symbol UBALD1
Synonyms UBA Like Domain Containing 1; Family With Sequence Similarity 100, Member A; FAM100A; UBA-Like Domain-Containing Protein 1; UBA-Like Domain Containing 1; Protein FAM100A; PP11303; UBA-like domain-containing protein 1; family with sequence similarity 100, member A; protein FAM100A
Gene ID 124402
mRNA Refseq NM_001330467
Protein Refseq NP_001317396
UniProt ID Q8TB05

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBALD1 Products

Required fields are marked with *

My Review for All UBALD1 Products

Required fields are marked with *

0
cart-icon