Recombinant Human UBALD1 Protein, GST-tagged
| Cat.No. : | UBALD1-3659H |
| Product Overview : | Human FAM100A full-length ORF ( NP_660296.1, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | UBALD1 (UBA Like Domain Containing 1) is a Protein Coding gene. An important paralog of this gene is UBALD2. |
| Molecular Mass : | 45.4 kDa |
| AA Sequence : | MSVNMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYSHHHHQMMCTPANTPATPPNFPDALTMFSRLKASESFHSGGSGSPMAATATSPPPHFPHAATSSSAASSWPTAASPPGGPQHHQPQPPLWTPTPPSPASDWPPLAPQQATSEPRAHPAMEAER |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | UBALD1 UBA like domain containing 1 [ Homo sapiens (human) ] |
| Official Symbol | UBALD1 |
| Synonyms | UBA Like Domain Containing 1; Family With Sequence Similarity 100, Member A; FAM100A; UBA-Like Domain-Containing Protein 1; UBA-Like Domain Containing 1; Protein FAM100A; PP11303; UBA-like domain-containing protein 1; family with sequence similarity 100, member A; protein FAM100A |
| Gene ID | 124402 |
| mRNA Refseq | NM_001330467 |
| Protein Refseq | NP_001317396 |
| UniProt ID | Q8TB05 |
| ◆ Recombinant Proteins | ||
| UBALD1-4445HF | Recombinant Full Length Human UBALD1 Protein, GST-tagged | +Inquiry |
| UBALD1-3659H | Recombinant Human UBALD1 Protein, GST-tagged | +Inquiry |
| Ubald1-6772M | Recombinant Mouse Ubald1 Protein, Myc/DDK-tagged | +Inquiry |
| UBALD1-210H | Recombinant Human FAM100A Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBALD1 Products
Required fields are marked with *
My Review for All UBALD1 Products
Required fields are marked with *
