Recombinant Human UCHL1 protein(71-150 aa), C-His-tagged
| Cat.No. : | UCHL1-2618H |
| Product Overview : | Recombinant Human UCHL1 protein(P09936)(71-150 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 71-150 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 12 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | KGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEG |
| Gene Name | UCHL1 ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) [ Homo sapiens ] |
| Official Symbol | UCHL1 |
| Synonyms | UCHL1; ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase); PARK5; ubiquitin carboxyl-terminal hydrolase isozyme L1; PGP9.5; Uch L1; ubiquitin thioesterase L1; neuron cytoplasmic protein 9.5; ubiquitin C-terminal hydrolase; PGP95; Uch-L1; PGP 9.5; |
| Gene ID | 7345 |
| mRNA Refseq | NM_004181 |
| Protein Refseq | NP_004172 |
| MIM | 191342 |
| UniProt ID | P09936 |
| ◆ Recombinant Proteins | ||
| Uchl1-6819M | Recombinant Mouse Uchl1 Protein, Myc/DDK-tagged | +Inquiry |
| Uchl1-20M | Active Recombinant Mouse Uchl1 protein(Gln2-Ala223), His-tagged | +Inquiry |
| UCHL1-6074R | Recombinant Rat UCHL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| UCHL1-2619H | Recombinant Human UCHL1 protein(61-150 aa), C-His-tagged | +Inquiry |
| Uchl1-17R | Recombinant Rat Uchl1 protein, His/S-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UCHL1-535HCL | Recombinant Human UCHL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UCHL1 Products
Required fields are marked with *
My Review for All UCHL1 Products
Required fields are marked with *
