Recombinant Human UFM1 Protein, GST-tagged
| Cat.No. : | UFM1-3580H |
| Product Overview : | Recombinant Human UFM1 Protein(1-85 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | July 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-85 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | UFM1 ubiquitin-fold modifier 1 [ Homo sapiens ] |
| Official Symbol | UFM1 |
| Synonyms | UFM1; ubiquitin-fold modifier 1; C13orf20, chromosome 13 open reading frame 20; bA131P10.1; BM-002; C13orf20; |
| Gene ID | 51569 |
| mRNA Refseq | NM_016617 |
| Protein Refseq | NP_057701 |
| MIM | 610553 |
| UniProt ID | P61960 |
| ◆ Recombinant Proteins | ||
| UFM1-4907R | Recombinant Rhesus Macaque UFM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| UFM1-701H | Active Recombinant Human UFM1 Protein, His-tagged | +Inquiry |
| UFM1-704H | Active Recombinant Human UFM1 | +Inquiry |
| UFM1-9878M | Recombinant Mouse UFM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| UFM1-703H | Active Recombinant Human UFM1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UFM1-519HCL | Recombinant Human UFM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UFM1 Products
Required fields are marked with *
My Review for All UFM1 Products
Required fields are marked with *
