Recombinant Human USP47 protein, GST-tagged
| Cat.No. : | USP47-16H |
| Product Overview : | Recombinant Human USP47(1 a.a. - 157 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-157 a.a. |
| Description : | USP47 played an important role in many functions. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 44.5 kDa |
| AA Sequence : | MKSMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFPCDISVLDIHQDLD WNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAP NKDLTQD |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | USP47 ubiquitin specific peptidase 47 [ Homo sapiens ] |
| Official Symbol | USP47 |
| Synonyms | USP47; ubiquitin specific peptidase 47; Trf (TATA binding protein related factor) proximal homolog (Drosophila) , ubiquitin specific protease 47; ubiquitin carboxyl-terminal hydrolase 47; ubiquitin thioesterase 47; deubiquitinating enzyme 47; ubiquitin thiolesterase 47; ubiquitin specific protease 47; ubiquitin-specific-processing protease 47; Trf (TATA binding protein-related factor)-proximal homolog; TRFP; FLJ20727; DKFZp686C13257; |
| Gene ID | 55031 |
| mRNA Refseq | NM_017944 |
| Protein Refseq | NP_060414 |
| MIM | 614460 |
| UniProt ID | Q96K76 |
| Chromosome Location | 11p15.2 |
| Function | WD40-repeat domain binding; cysteine-type peptidase activity; peptidase activity; protein binding; ubiquitin thiolesterase activity; ubiquitin-specific protease activity; |
| ◆ Recombinant Proteins | ||
| USP47-4400C | Recombinant Chicken USP47 | +Inquiry |
| USP47-1341S | Recombinant Human USP47 Protein (V2-D1375), His/Flag tagged | +Inquiry |
| USP47-157H | Recombinant Human USP47, His-tagged | +Inquiry |
| USP47-9971M | Recombinant Mouse USP47 Protein, His (Fc)-Avi-tagged | +Inquiry |
| USP47-1342S | Recombinant Human USP47 Protein (V2-D1375), Flag tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| USP47-728HCL | Recombinant Human USP47 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP47 Products
Required fields are marked with *
My Review for All USP47 Products
Required fields are marked with *
