Recombinant Human USP47 protein, GST-tagged

Cat.No. : USP47-16H
Product Overview : Recombinant Human USP47(1 a.a. - 157 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-157 a.a.
Description : USP47 played an important role in many functions.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 44.5 kDa
AA Sequence : MKSMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFPCDISVLDIHQDLD WNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAP NKDLTQD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name USP47 ubiquitin specific peptidase 47 [ Homo sapiens ]
Official Symbol USP47
Synonyms USP47; ubiquitin specific peptidase 47; Trf (TATA binding protein related factor) proximal homolog (Drosophila) , ubiquitin specific protease 47; ubiquitin carboxyl-terminal hydrolase 47; ubiquitin thioesterase 47; deubiquitinating enzyme 47; ubiquitin thiolesterase 47; ubiquitin specific protease 47; ubiquitin-specific-processing protease 47; Trf (TATA binding protein-related factor)-proximal homolog; TRFP; FLJ20727; DKFZp686C13257;
Gene ID 55031
mRNA Refseq NM_017944
Protein Refseq NP_060414
MIM 614460
UniProt ID Q96K76
Chromosome Location 11p15.2
Function WD40-repeat domain binding; cysteine-type peptidase activity; peptidase activity; protein binding; ubiquitin thiolesterase activity; ubiquitin-specific protease activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All USP47 Products

Required fields are marked with *

My Review for All USP47 Products

Required fields are marked with *

0
cart-icon
0
compare icon