Recombinant Human USP47 protein, GST-tagged USP47-16H

Recombinant Human USP47 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human USP47 protein, GST-tagged

Recombinant Human USP47 protein, GST-tagged

USP47 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : USP47-16H
Product Overview : Recombinant Human USP47(1 a.a. - 157 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description : USP47 played an important role in many functions.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 44.5 kDa
AA Sequence : MKSMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFPCDISVLDIHQDLD WNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAP NKDLTQD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : USP47 ubiquitin specific peptidase 47 [ Homo sapiens ]
Official Symbol : USP47
Synonyms : USP47; ubiquitin specific peptidase 47; Trf (TATA binding protein related factor) proximal homolog (Drosophila) , ubiquitin specific protease 47; ubiquitin carboxyl-terminal hydrolase 47; ubiquitin thioesterase 47; deubiquitinating enzyme 47; ubiquitin thiolesterase 47; ubiquitin specific protease 47; ubiquitin-specific-processing protease 47; Trf (TATA binding protein-related factor)-proximal homolog; TRFP; FLJ20727; DKFZp686C13257;
Gene ID : 55031
mRNA Refseq : NM_017944
Protein Refseq : NP_060414
MIM : 614460
UniProt ID : Q96K76
Chromosome Location : 11p15.2
Function : WD40-repeat domain binding; cysteine-type peptidase activity; peptidase activity; protein binding; ubiquitin thiolesterase activity; ubiquitin-specific protease activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy