"VTCN1" Related Products

Expand
Expand
Expand

Recombinant Human VTCN1 protein, T7/His-tagged

Cat.No.: VTCN1-116H
Product Overview: Recombinant human VTCN1 extracellular domain cDNA (25-259aa, Isoform-1, derived from BC074729) fused with T7/His/TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGEFLIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQW LKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYK TGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINN TYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAS
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro VTCN1 mediated T cell differentiation regulation study with this protein as either soluble factor or coating matrix protein.2. May be used for mapping VTCN1 protein-protein interaction assay.3. Potential biomarker protein for clinical applications such as monitoring pancreatic cancer progression.4. As antigen for specific antibody production.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: VTCN1 V-set domain containing T cell activation inhibitor 1 [ Homo sapiens ]
Official Symbol: VTCN1
Synonyms: VTCN1; V-set domain containing T cell activation inhibitor 1; V-set domain-containing T-cell activation inhibitor 1; B7 family member; H4; B7 superfamily member 1; B7 H4; B7H4; B7S1; B7X; FLJ22418; B7 family member, H4; T cell costimulatory molecule B7x; T-cell costimulatory molecule B7x; immune costimulatory protein B7-H4; B7-H4; B7h.5; VCTN1; PRO1291; RP11-229A19.4;
Gene ID: 79679
mRNA Refseq: NM_001253849
Protein Refseq: NP_001240778
MIM: 608162
UniProt ID: Q7Z7D3
Chromosome Location: 1p12
Function: receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.