Recombinant Human VWC2L Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | VWC2L-1527H |
| Product Overview : | VWC2L MS Standard C13 and N15-labeled recombinant protein (NP_001073969) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | VWC2L (Von Willebrand Factor C Domain Containing 2 Like) is a Protein Coding gene. Diseases associated with VWC2L include Spinocerebellar Ataxia 36 and Mental Retardation, Enteropathy, Deafness, Peripheral Neuropathy, Ichthyosis, And Keratoderma. An important paralog of this gene is VWC2. |
| Molecular Mass : | 24.4 kDa |
| AA Sequence : | MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQISSNDNLIFDDYRGKGCVDDSGFVYKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHGKNYKILEEFKPSPCEWCRCEPSNEVHCVVADCAVPECVNPVYEPEQCCPVCKNGPNCFAGTTIIPAGIEVKVDECNICHCHNGDWWKPAQCSKRECQGKQTVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | VWC2L von Willebrand factor C domain containing 2 like [ Homo sapiens (human) ] |
| Official Symbol | VWC2L |
| Synonyms | VWC2L; von Willebrand factor C domain containing 2 like; von Willebrand factor C domain-containing protein 2-like; brorin-like; von Willebrand factor C domain containing protein 2 like |
| Gene ID | 402117 |
| mRNA Refseq | NM_001080500 |
| Protein Refseq | NP_001073969 |
| UniProt ID | B2RUY7 |
| ◆ Recombinant Proteins | ||
| VWC2L-6941Z | Recombinant Zebrafish VWC2L | +Inquiry |
| Vwc2l-6960M | Recombinant Mouse Vwc2l Protein, Myc/DDK-tagged | +Inquiry |
| VWC2L-1817H | Recombinant Human VWC2L | +Inquiry |
| vwc2l-5750Z | Recombinant Zebrafish vwc2l protein, His-tagged | +Inquiry |
| VWC2L-2350H | Recombinant Human VWC2L Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VWC2L Products
Required fields are marked with *
My Review for All VWC2L Products
Required fields are marked with *
