Recombinant Human VWC2L Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: VWC2L-1527H
• Product Overview: VWC2L MS Standard C13 and N15-labeled recombinant protein (NP_001073969) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: VWC2L (Von Willebrand Factor C Domain Containing 2 Like) is a Protein Coding gene. Diseases associated with VWC2L include Spinocerebellar Ataxia 36 and Mental Retardation, Enteropathy, Deafness, Peripheral Neuropathy, Ichthyosis, And Keratoderma. An important paralog of this gene is VWC2.
• Molecular Mass: 24.4 kDa
• AA Sequence: MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQISSNDNLIFDDYRGKGCVDDSGFVYKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHGKNYKILEEFKPSPCEWCRCEPSNEVHCVVADCAVPECVNPVYEPEQCCPVCKNGPNCFAGTTIIPAGIEVKVDECNICHCHNGDWWKPAQCSKRECQGKQTVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: VWC2L von Willebrand factor C domain containing 2 like [ Homo sapiens (human) ]
• Official Symbol: VWC2L
• Synonyms: VWC2L; von Willebrand factor C domain containing 2 like; von Willebrand factor C domain-containing protein 2-like; brorin-like; von Willebrand factor C domain containing protein 2 like
• Gene ID: 402117
• mRNA Refseq: NM_001080500
• Protein Refseq: NP_001073969
• UniProt ID: B2RUY7