Recombinant Human WFDC2 protein, His-tagged

• Cat.No.: WFDC2-6114H
• Product Overview: Recombinant Human WFDC2 protein(21-124 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 21-124 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: GFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: WFDC2 WAP four-disulfide core domain 2 [ Homo sapiens ]
• Official Symbol: WFDC2
• Synonyms: WFDC2; WAP four-disulfide core domain 2; WAP four-disulfide core domain protein 2; dJ461P17.6; EDDM4; epididymal protein 4; HE4; WAP5; epididymal secretory protein E4; putative protease inhibitor WAP5; WAP domain containing protein HE4-V4; major epididymis-specific protein E4; epididymis-specific, whey-acidic protein type, four-disulfide core; MGC57529
• Gene ID: 10406
• mRNA Refseq: NM_006103
• Protein Refseq: NP_006094
• UniProt ID: Q14508