Recombinant Human WNT2B protein, His-tagged
| Cat.No. : | WNT2B-3339H |
| Product Overview : | Recombinant Human WNT2B protein(253-297 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 253-297 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | RALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | WNT2B wingless-type MMTV integration site family, member 2B [ Homo sapiens ] |
| Official Symbol | WNT2B |
| Synonyms | WNT2B; wingless-type MMTV integration site family, member 2B; WNT13; protein Wnt-2b; wingless type MMTV integration site family; member 13; XWNT2; Xenopus; homolog of; XWNT2, Xenopus, homolog of; wingless-type MMTV integration site family, member 13; |
| Gene ID | 7482 |
| mRNA Refseq | NM_004185 |
| Protein Refseq | NP_004176 |
| MIM | 601968 |
| UniProt ID | Q93097 |
| ◆ Recombinant Proteins | ||
| Wnt2b-239M | Active Recombinant Mouse Wnt2b | +Inquiry |
| WNT2B-10195M | Recombinant Mouse WNT2B Protein, His (Fc)-Avi-tagged | +Inquiry |
| WNT2B-18569M | Recombinant Mouse WNT2B Protein | +Inquiry |
| WNT2B-5908C | Recombinant Chicken WNT2B | +Inquiry |
| WNT2B-06H | Recombinant Full Length Human WNT2B Protein, His&GST tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WNT2B-297HCL | Recombinant Human WNT2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNT2B Products
Required fields are marked with *
My Review for All WNT2B Products
Required fields are marked with *



