Recombinant Human WNT7B protein, StrepII/His-tagged
| Cat.No. : | WNT7B-241H |
| Product Overview : | Recombinant Human WNT7B(32-349a.a.) fused with StrepII tag at N-terminus and His tag at C-terminus was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His&Strep II |
| Protein Length : | 32-349 a.a. |
| Description : | Wnt7B is a ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. |
| Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
| Molecular Mass : | 35.7 kDa |
| AA Sequence : | LGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAAC SQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLP KFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQY TKVWQCNCKFHWCCFVKCNTCSERTEVFTCK |
| Endotoxin : | <0.1 EU per ug protein by LAL method |
| Purity : | >80% pure by SDS-PAGE |
| Storage : | 12 months at -20 centigrade as supplied; 1 month at 4 centigrade after reconstitution. Avoid freeze/thaw cycles. |
| Reconstitution : | Centrifuge the vial prior to opening. Reconstitute with 20ul PBS to a concentration of 0.1 mg/ml. |
| Gene Name | WNT7B wingless-type MMTV integration site family, member 7B [ Homo sapiens ] |
| Official Symbol | WNT7B |
| Synonyms | WNT7B; wingless-type MMTV integration site family, member 7B; protein Wnt-7b; |
| Gene ID | 7477 |
| mRNA Refseq | NM_058238 |
| Protein Refseq | NP_478679 |
| MIM | 601967 |
| UniProt ID | P56706 |
| Chromosome Location | 22q13 |
| Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; |
| Function | extracellular matrix structural constituent; frizzled binding; receptor binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNT7B Products
Required fields are marked with *
My Review for All WNT7B Products
Required fields are marked with *



