Recombinant Human XDH Protein, Full Length, C-FLAG tagged
Cat.No. : | ACBD7-6169HFL |
Product Overview : | Recombinant protein of human acyl-Coenzyme A binding domain containing 7 (ACBD7) with C-FLAG tag was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Flag |
Protein Length : | Full Length |
Description : | Binds medium- and long-chain acyl-CoA esters. |
Molecular Mass : | 9.6 kDa |
AA Sequence : | MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >0.05 μg/μL as determined by microplate BCA method |
Storage Buffer : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Gene Name | ACBD7 acyl-CoA binding domain containing 7 [ Homo sapiens (human) ] |
Official Symbol | ACBD7 |
Synonyms | ACBD7; acyl-CoA binding domain containing 7; acyl Coenzyme A binding domain containing 7; acyl-CoA-binding domain-containing protein 7; bA455B2.2; FLJ38219; acyl-Coenzyme A binding domain containing 7; FLJ52263; MGC33893 |
Gene ID | 414149 |
mRNA Refseq | NM_001039844 |
Protein Refseq | NP_001034933 |
UniProt ID | Q8N6N7 |
◆ Recombinant Proteins | ||
Acbd7-1492M | Recombinant Mouse Acbd7 Protein, Myc/DDK-tagged | +Inquiry |
ACBD7-534H | Recombinant Human ACBD7, His tagged | +Inquiry |
ACBD7-6168H | Recombinant Human ACBD7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACBD7-6169HFL | Recombinant Human XDH Protein, Full Length, C-FLAG tagged | +Inquiry |
ACBD7-7030Z | Recombinant Zebrafish ACBD7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACBD7-9104HCL | Recombinant Human ACBD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACBD7 Products
Required fields are marked with *
My Review for All ACBD7 Products
Required fields are marked with *
0
Inquiry Basket