"YARS" Related Products

Expand
Expand

Recombinant Human YARS protein, T7/His-tagged

Cat.No.: YARS-207H
Product Overview: Recombinant human YARS N-terminal fragment (Mini-TyrRA) cDNA (2 – 364 aa, derived from BC016689) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGK PHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTD YQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEK YLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLK SEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQ KPMAKGPAKNSEPEEVI
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro Mini-YARS protein mediated interleukine-8 like activities regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for Mini-YARS protein – protein interaction assay.3. As Enzymatic substrate for various proteases.4. May be used for specific antibody production.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: YARS tyrosyl-tRNA synthetase [ Homo sapiens ]
Official Symbol: YARS
Synonyms: YARS; tyrosyl-tRNA synthetase; tyrosine--tRNA ligase, cytoplasmic; tyrosine tRNA ligase 1; cytoplasmic; tyrRS; YRS; YTS; tyrosyl--tRNA ligase; tyrosine tRNA ligase 1, cytoplasmic; tyrosyl-tRNA synthetase, cytoplasmic; TYRRS; CMTDIC;
Gene ID: 8565
mRNA Refseq: NM_003680
Protein Refseq: NP_003671
MIM: 603623
UniProt ID: P54577
Chromosome Location: 1p35.1
Pathway: Aminoacyl-tRNA biosynthesis, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, conserved biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, conserved biosystem; Cytosolic tRNA aminoacylation, organism-specific biosystem; Gene Expression, organism-specific biosystem; tRNA Aminoacylation, organism-specific biosystem;
Function: ATP binding; interleukin-8 receptor binding; ligase activity; nucleotide binding; signal transducer activity; tRNA binding; tyrosine-tRNA ligase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.