Recombinant Human ZNF134 protein, GST-tagged
| Cat.No. : | ZNF134-301130H |
| Product Overview : | Recombinant Human ZNF134 (96-179 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Tyr96-Ser179 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | YQKCYSIEQPLRRDKSEASIVRNCTVSKEPHPSEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCS |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | ZNF134 zinc finger protein 134 [ Homo sapiens ] |
| Official Symbol | ZNF134 |
| Synonyms | ZNF134; zinc finger protein 134; zinc finger protein 134 (clone pHZ 15); pHZ 15; zinc finger protein 134 (clone pHZ-15); pHZ-15; MGC138499; MGC141970; |
| Gene ID | 7693 |
| mRNA Refseq | NM_003435 |
| Protein Refseq | NP_003426 |
| MIM | 604076 |
| UniProt ID | P52741 |
| ◆ Recombinant Proteins | ||
| ZNF134-301130H | Recombinant Human ZNF134 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZNF134-1986HCL | Recombinant Human ZNF134 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF134 Products
Required fields are marked with *
My Review for All ZNF134 Products
Required fields are marked with *
