Recombinant Infectious bronchitis virus Profilin Protein, His-tagged
Cat.No. : | PRF-1339I |
Product Overview : | Recombinant Infectious bronchitis virus Profilin Protein (2-163aa) was expressed in Yeast with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Infectious bronchitis virus |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-163 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 19.4 kDa |
AA Sequence : | SDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEAS TIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKE QDKGNSRTSALAFAEYLHQSGY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
◆ Recombinant Proteins | ||
Profilin-4337A | Recombinant Annual mercury Profilin protein, His-SUMO-tagged | +Inquiry |
PRF-1339I | Recombinant Infectious bronchitis virus Profilin Protein, His-tagged | +Inquiry |
Profilin-5745A | Recombinant Annual mercury Profilin protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Profilin Products
Required fields are marked with *
My Review for All Profilin Products
Required fields are marked with *