Recombinant Leech Hirudin therapeutic protein(Lepirudin)
Cat.No. : | Hirudin-P030L |
Product Overview : | Lepirudin is identical to natural hirudin except for substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. It is produced via yeast cells. |
Availability | February 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Leech |
Source : | Yeast |
Tag : | Non |
ProteinLength : | 65 Aa |
Description : | The expression product is the active ingredient of Refludan. |
Molecular Mass : | 6963.4 Da |
AA Sequence : | LVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | Hirudin; Lepirudin |
◆ Recombinant Proteins | ||
RBM4-31230TH | Recombinant Full Length Human RBM4, His-tagged | +Inquiry |
PNPLA3-1820H | Recombinant Human PNPLA3 protein, His-tagged | +Inquiry |
Scyb11-5251M | Recombinant Mouse Scyb11 protein, His-tagged | +Inquiry |
CAMK2N1B-8508Z | Recombinant Zebrafish CAMK2N1B | +Inquiry |
NOG-30339TH | Recombinant Human NOG | +Inquiry |
◆ Native Proteins | ||
FG-116H | Native Human Fibrinogen | +Inquiry |
TNNC1-25H | Native Human TNNC1 protein | +Inquiry |
PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
IGFBP1-612H | Native Human Insulin-like Growth Factor Binding Protein 1 | +Inquiry |
Hyaluronidase-34O | Active Native Ovine Hyaluronidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLPB-368HCL | Recombinant Human CLPB cell lysate | +Inquiry |
GSR-757HCL | Recombinant Human GSR cell lysate | +Inquiry |
SLC35E4-1729HCL | Recombinant Human SLC35E4 293 Cell Lysate | +Inquiry |
CPT2-391HCL | Recombinant Human CPT2 cell lysate | +Inquiry |
SPATA18-1539HCL | Recombinant Human SPATA18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Hirudin Products
Required fields are marked with *
My Review for All Hirudin Products
Required fields are marked with *
0
Inquiry Basket