Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT Protein, His-SUMO-tagged
| Cat.No. : | LqhaIT-1116L |
| Product Overview : | Recombinant Alpha-insect toxin LqhaIT Protein (20-85aa) was expressed in E. coli with His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Leiurus quinquestriatus hebraeus |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 20-85 a.a. |
| Description : | Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The dissociation is voltage-dependent. This toxin is active on insects. It is also highly toxic to crustaceans and has a measurable but low toxicity to mice. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 23.5 kDa |
| AA Sequence : | VRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCHRK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Alpha-insect toxin LqhaIT |
| Official Symbol | Alpha-insect toxin LqhaIT |
| Synonyms | Alpha-insect toxin LqhaIT; LqhaIT; Lqh-alpha-IT; Alpha-IT |
| UniProt ID | P17728 |
| ◆ Recombinant Proteins | ||
| LqhaIT-1116L | Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Alpha-insect toxin LqhaIT Products
Required fields are marked with *
My Review for All Alpha-insect toxin LqhaIT Products
Required fields are marked with *
Recently Viewed
