Recombinant Lolium perenne Major pollen allergen Lol p 5a Protein, His-SUMO/MYC-tagged

Cat.No. : LOLPIB-1268L
Product Overview : Recombinant Lolium perenne Major pollen allergen Lol p 5a Protein (26-307aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Lolium perenne
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 26-307 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 48.4 kDa
AA Sequence : ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQSLISLLIYY
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Major pollen allergen Lol p 5a
Official Symbol Major pollen allergen Lol p 5a
Synonyms Major pollen allergen Lol p 5a; Allergen Lol p Ib; Allergen Lol p Va; Lol p 5a
UniProt ID Q40240

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Major pollen allergen Lol p 5a Products

Required fields are marked with *

My Review for All Major pollen allergen Lol p 5a Products

Required fields are marked with *

0
cart-icon