Recombinant Lolium perenne Major pollen allergen Lol p 5a Protein, His-SUMO/MYC-tagged
| Cat.No. : | LOLPIB-1268L |
| Product Overview : | Recombinant Lolium perenne Major pollen allergen Lol p 5a Protein (26-307aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Lolium perenne |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 26-307 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 48.4 kDa |
| AA Sequence : | ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQSLISLLIYY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Major pollen allergen Lol p 5a |
| Official Symbol | Major pollen allergen Lol p 5a |
| Synonyms | Major pollen allergen Lol p 5a; Allergen Lol p Ib; Allergen Lol p Va; Lol p 5a |
| UniProt ID | Q40240 |
| ◆ Recombinant Proteins | ||
| LOLPIB-1268L | Recombinant Lolium perenne Major pollen allergen Lol p 5a Protein, His-SUMO/MYC-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Major pollen allergen Lol p 5a Products
Required fields are marked with *
My Review for All Major pollen allergen Lol p 5a Products
Required fields are marked with *
