Recombinant Mouse Aicda protein, His&Myc-tagged
| Cat.No. : | Aicda-2495M |
| Product Overview : | Recombinant Mouse Aicda protein(Q9WVE0)(1-198aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-198aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 31.5 kDa |
| AA Sequence : | MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Aicda activation-induced cytidine deaminase [ Mus musculus ] |
| Official Symbol | Aicda |
| Synonyms | AICDA; activation-induced cytidine deaminase; cytidine aminohydrolase; activation induced deaminase; Aid; Arp2; |
| Gene ID | 11628 |
| mRNA Refseq | NM_009645 |
| Protein Refseq | NP_033775 |
| ◆ Recombinant Proteins | ||
| AICDA-409M | Recombinant Mouse AICDA Protein, His (Fc)-Avi-tagged | +Inquiry |
| AICDA-4514C | Recombinant Chicken AICDA | +Inquiry |
| AICDA-2783H | Recombinant Human AICDA Protein (1-198 aa), His-Myc-tagged | +Inquiry |
| AICDA-953HF | Recombinant Full Length Human AICDA Protein, GST-tagged | +Inquiry |
| AICDA-1868Z | Recombinant Zebrafish AICDA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AICDA-8958HCL | Recombinant Human AICDA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Aicda Products
Required fields are marked with *
My Review for All Aicda Products
Required fields are marked with *



