"Apoe" Related Products

Expand
Expand

Recombinant Mouse Aope Protein, His-tagged

Cat.No. : Apoe-1128M
Product Overview : Recombinant Mouse Aope Protein (19-311aa) was expressed in yeast with 6His tag.
Source : Yeast
Species : Mouse
Tag : His
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 36 kDa
AA Sequence : EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name : Apoe apolipoprotein E [ Mus musculus (house mouse) ]
Official Symbol : Apoe
Synonyms : Apoe; apolipoprotein E; Apo-E; AI255918
Gene ID : 11816
mRNA Refseq : NM_001305819.1
Protein Refseq : NP_001292748.1
UniProt ID : P08226

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.