Recombinant Mouse Apoa2, GST-tagged
| Cat.No. : | Apoa2-18M |
| Product Overview : | Recombinant Mouse Apoa2 (24 a.a. - 102 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Apolipoprotein A-II is a protein that in humans is encoded by the APOA2 gene. |
| Molecular Mass : | 34.32 kDa |
| AA Sequence : | QADGPDMQSLFTQYFQSMTEYGKDLVEKAKTSEIQSQVKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPA PAAK |
| Applications : | ELISA; WB-Re; AP; Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | Apoa2?apolipoprotein A-II [?Mus musculus?(house mouse) ] |
| Official Symbol | Apoa2 |
| Synonyms | Apoa2; Alp-2; Hdl-1; ApoAII; Apoa-2; ApoA-II; apolipoprotein A-II; apo-AII; apolipoprotein A2 |
| Gene ID | 11807 |
| mRNA Refseq | NM_013474 |
| Protein Refseq | NP_038502 |
| UniProt ID | P09813 |
| Chromosome Location | 1 H3; 1 79.22 cM |
| Pathway | Chylomicron-mediated lipid transport; Fatty acid, triacylglycerol, and ketone body metabolism; Metabolism of lipids and lipoproteins |
| Function | apolipoprotein receptor binding; cholesterol transporter activity; contributes_to cholesterol transporter activity |
| ◆ Recombinant Proteins | ||
| APOA2-208D | Recombinant Dog APOA2 Protein, His&GST-tagged | +Inquiry |
| Apoa2-3566R | Recombinant Rat Apoa2, GST-tagged | +Inquiry |
| Apoa2-6743M | Recombinant Mouse Apoa2 protein, hFc-tagged | +Inquiry |
| APOA2-1112HF | Recombinant Full Length Human APOA2 Protein, GST-tagged | +Inquiry |
| APOA2-7070Z | Recombinant Zebrafish APOA2 | +Inquiry |
| ◆ Native Proteins | ||
| APOA2-8036H | Native Human ApoLipoprotein APOA2 | +Inquiry |
| ApoC-II-3558H | Native Human ApoC-II | +Inquiry |
| APOA2-5302H | Native Human Apolipoprotein A-II | +Inquiry |
| APOA2-4772H | Native Human Apolipoprotein AII protein | +Inquiry |
| ApoA-II-3555H | Native Human ApoA-II | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOA2-8789HCL | Recombinant Human APOA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Apoa2 Products
Required fields are marked with *
My Review for All Apoa2 Products
Required fields are marked with *



