Recombinant Mouse ASAH1 Protein (19-141 aa), His-GST-Myc-tagged

Cat.No. : ASAH1-2093M
Product Overview : Recombinant Mouse ASAH1 Protein (19-141 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-GST tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : GST&His&Myc
Protein Length : 19-141 aa
Description : Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 43.8 kDa
AA Sequence : QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Asah1 N-acylsphingosine amidohydrolase 1 [ Mus musculus ]
Official Symbol ASAH1
Synonyms ASAH1; acid ceramidase; ACDase; acid CDase; acylsphingosine deacylase; AC; Asah; 2310081N20Rik;
Gene ID 11886
mRNA Refseq NM_019734
Protein Refseq NP_062708
UniProt ID Q9WV54

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASAH1 Products

Required fields are marked with *

My Review for All ASAH1 Products

Required fields are marked with *

0
cart-icon