Recombinant Mouse ASAH1 Protein (19-141 aa), His-GST-Myc-tagged

• Cat.No.: ASAH1-2093M
• Product Overview: Recombinant Mouse ASAH1 Protein (19-141 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-GST tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Mouse
• Source: E.coli
• Tag: GST&His&Myc
• Protein Length: 19-141 aa
• Description: Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 43.8 kDa
• AA Sequence: QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Asah1 N-acylsphingosine amidohydrolase 1 [ Mus musculus ]
• Official Symbol: ASAH1
• Synonyms: ASAH1; acid ceramidase; ACDase; acid CDase; acylsphingosine deacylase; AC; Asah; 2310081N20Rik
• Gene ID: 11886
• mRNA Refseq: NM_019734
• Protein Refseq: NP_062708
• UniProt ID: Q9WV54