Recombinant Mouse ASAH1 Protein (19-141 aa), His-GST-Myc-tagged
Cat.No. : | ASAH1-2093M |
Product Overview : | Recombinant Mouse ASAH1 Protein (19-141 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-GST tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 19-141 aa |
Description : | Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 43.8 kDa |
AA Sequence : | QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Asah1 N-acylsphingosine amidohydrolase 1 [ Mus musculus ] |
Official Symbol | ASAH1 |
Synonyms | ASAH1; acid ceramidase; ACDase; acid CDase; acylsphingosine deacylase; AC; Asah; 2310081N20Rik; |
Gene ID | 11886 |
mRNA Refseq | NM_019734 |
Protein Refseq | NP_062708 |
UniProt ID | Q9WV54 |
◆ Recombinant Proteins | ||
ASAH1-315C | Recombinant Cynomolgus ASAH1 Protein, His-tagged | +Inquiry |
ASAH1-6469HFL | Recombinant Full Length Human ASAH1 protein, Flag-tagged | +Inquiry |
ASAH1-1134H | Recombinant Human ASAH1 Protein, His-SUMO-tagged | +Inquiry |
ASAH1-3526H | Recombinant Human ASAH1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Asah1-655M | Recombinant Mouse Asah1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASAH1-8670HCL | Recombinant Human ASAH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASAH1 Products
Required fields are marked with *
My Review for All ASAH1 Products
Required fields are marked with *
0
Inquiry Basket