Recombinant Mouse CHID1 Protein (20-393 aa), His-tagged

Cat.No. : CHID1-2791M
Product Overview : Recombinant Mouse CHID1 Protein (20-393 aa) is produced by Baculovirus expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Tag : His
Protein Length : 20-393 aa
Description : Saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose (in vitro).
Form : Tris-based buffer,50% glycerol
Molecular Mass : 44.7 kDa
AA Sequence : TLSKSDAKKAASKMLLEKTQFSDKPVQDRGLVVTDIKAEDVVLEHRSYCSSRARERNFAGEVLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGREMFEITGLHDVDQGWMRAVKKHAKGVRIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVAQVAKNQHFDGFVVEVWSQLLSQKHVGLIHMLTHLAEALHQARLLVILVIPPAVTPGTDQLGMFTHKEFEQLAPILDGFSLMTYDYSTSQQPGPNAPLSWIRACVQVLDPKSQWRSKILLGLNFYGMDYAASKDAREPVIGARYVQTLKDHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Chid1 chitinase domain containing 1 [ Mus musculus ]
Official Symbol CHID1
Synonyms CHID1; chitinase domain containing 1; chitinase domain-containing protein 1; AI841869; 3110023E09Rik;
Gene ID 68038
mRNA Refseq NM_001142681
Protein Refseq NP_001136153
UniProt ID Q922Q9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHID1 Products

Required fields are marked with *

My Review for All CHID1 Products

Required fields are marked with *

0
cart-icon