Recombinant Mouse CHID1 Protein (20-393 aa), His-tagged
Cat.No. : | CHID1-2791M |
Product Overview : | Recombinant Mouse CHID1 Protein (20-393 aa) is produced by Baculovirus expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 20-393 aa |
Description : | Saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose (in vitro). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 44.7 kDa |
AA Sequence : | TLSKSDAKKAASKMLLEKTQFSDKPVQDRGLVVTDIKAEDVVLEHRSYCSSRARERNFAGEVLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGREMFEITGLHDVDQGWMRAVKKHAKGVRIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVAQVAKNQHFDGFVVEVWSQLLSQKHVGLIHMLTHLAEALHQARLLVILVIPPAVTPGTDQLGMFTHKEFEQLAPILDGFSLMTYDYSTSQQPGPNAPLSWIRACVQVLDPKSQWRSKILLGLNFYGMDYAASKDAREPVIGARYVQTLKDHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Chid1 chitinase domain containing 1 [ Mus musculus ] |
Official Symbol | CHID1 |
Synonyms | CHID1; chitinase domain containing 1; chitinase domain-containing protein 1; AI841869; 3110023E09Rik; |
Gene ID | 68038 |
mRNA Refseq | NM_001142681 |
Protein Refseq | NP_001136153 |
UniProt ID | Q922Q9 |
◆ Recombinant Proteins | ||
CHID1-1030R | Recombinant Rat CHID1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHID1-5129H | Recombinant Human CHID1 protein, His-tagged | +Inquiry |
CHID1-3397M | Recombinant Mouse CHID1 Protein | +Inquiry |
CHID1-846R | Recombinant Rhesus monkey CHID1 Protein, His-tagged | +Inquiry |
Chid1-5123M | Recombinant Mouse Chid1 protein, His-Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHID1-7536HCL | Recombinant Human CHID1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHID1 Products
Required fields are marked with *
My Review for All CHID1 Products
Required fields are marked with *