Recombinant Mouse CHID1 Protein (20-393 aa), His-tagged

• Cat.No.: CHID1-2791M
• Product Overview: Recombinant Mouse CHID1 Protein (20-393 aa) is produced by Baculovirus expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: Insect Cells
• Tag: His
• Protein Length: 20-393 aa
• Description: Saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose (in vitro).
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 44.7 kDa
• AA Sequence: TLSKSDAKKAASKMLLEKTQFSDKPVQDRGLVVTDIKAEDVVLEHRSYCSSRARERNFAGEVLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGREMFEITGLHDVDQGWMRAVKKHAKGVRIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVAQVAKNQHFDGFVVEVWSQLLSQKHVGLIHMLTHLAEALHQARLLVILVIPPAVTPGTDQLGMFTHKEFEQLAPILDGFSLMTYDYSTSQQPGPNAPLSWIRACVQVLDPKSQWRSKILLGLNFYGMDYAASKDAREPVIGARYVQTLKDHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Chid1 chitinase domain containing 1 [ Mus musculus ]
• Official Symbol: CHID1
• Synonyms: CHID1; chitinase domain containing 1; chitinase domain-containing protein 1; AI841869; 3110023E09Rik
• Gene ID: 68038
• mRNA Refseq: NM_001142681
• Protein Refseq: NP_001136153
• UniProt ID: Q922Q9